Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: Q63699
Subject Sequence ID: ENSG00000008128
Subject Sequence type: 3

Query= sp|Q63699|CDK2_RAT Cell division protein kinase 2 (EC 2.7.1.37)
- Rattus norvegicus (Rat).
         (298 letters)

>ENSG00000008128
          Length = 21592

 Score = 61.6 bits (148), Expect(3) = 5e-30
 Identities = 26/44 (59%), Positives = 37/44 (84%)
 Frame = -3

Query: 174  LLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFR 217
            LL    YSTAVD+WS+GCIF E++T++ LFPG+SEIDQ+ ++F+
Sbjct: 1223 LLAS*EYSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFK 1092



 Score = 56.2 bits (134), Expect(3) = 5e-30
 Identities = 24/39 (61%), Positives = 31/39 (79%)
 Frame = -1

Query: 140  SIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCK 178
            S+++ DFGLAR +G P++ YT  VVT WYRAPE+LLG K
Sbjct: 1423 SLQVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGAK 1307



 Score = 46.2 bits (108), Expect = 2e-08
 Identities = 19/39 (48%), Positives = 30/39 (76%)
 Frame = -3

Query: 26   TGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIV 64
            T E+VALK+++++ E EG P T++REI+ + +  HPNIV
Sbjct: 2297 TDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIV 2181



 Score = 41.2 bits (95), Expect(3) = 5e-30
 Identities = 17/41 (41%), Positives = 29/41 (70%)
 Frame = -3

Query: 104  IKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLA 144
            +K+ + QLL+G+   H + +LHRDLK  NLL++  G +K++
Sbjct: 1607 VKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVS 1485



 Score = 38.9 bits (89), Expect = 4e-06
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = -2

Query: 1    MENFQKVEKIGEGTYGVVYKAKNKLTG 27
            +E FQ + +I EGTYGVVY+AK+K TG
Sbjct: 2988 VEEFQCLNRIEEGTYGVVYRAKDKKTG 2908



 Score = 32.0 bits (71), Expect = 5e-04
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -1

Query: 215 IFRTLGTPDEVVWPGVTSMPDYK 237
           +F+ LGTP E +WPG + +P  K
Sbjct: 901 VFQELGTPSEKIWPGYSELPVVK 833



 Score = 26.2 bits (56), Expect = 0.026
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = -2

Query: 60   HPNIVKLLDVIHTEN--KLYLVFEFLHQDLKKFMDASALTGLP 100
            HP    L +++   N  K+Y+V  ++  DLK  M+      LP
Sbjct: 1947 HPQSRALQEIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLP 1819



 Score = 20.8 bits (42), Expect = 1.1
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +1

Query: 237  KPSFPKWARQ 246
            +PS P+WA+Q
Sbjct: 4540 RPSLPQWAQQ 4569



 Score = 18.9 bits (37), Expect = 4.1
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +1

Query: 39   TETEGVPSTAIREISLLKELNHPNIVKLLD 68
            +E  G+P +  R+ S L+ ++    V LLD
Sbjct: 7051 SEARGLPGSPGRKSSNLEAVSPRTQVDLLD 7140



 Score = 18.5 bits (36), Expect = 5.4
 Identities = 10/36 (27%), Positives = 14/36 (38%)
 Frame = -3

Query: 220  GTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPL 255
            GTP          +PD     P   +Q+  K +P L
Sbjct: 4787 GTPQSSALTEGDYVPDSPALLPIELKQELPKYLPAL 4680



 Score = 18.1 bits (35), Expect = 7.1
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 185   DIWSLGCIFAEM 196
             D W L CIF  +
Sbjct: 13147 DSWPLVCIFVPL 13112



 Score = 18.1 bits (35), Expect = 7.1
 Identities = 6/19 (31%), Positives = 9/19 (47%)
 Frame = -1

Query: 184   VDIWSLGCIFAEMVTRRAL 202
             V +W L C ++    R  L
Sbjct: 16564 VQVWFLSCSYSSAFPRAPL 16508


Lambda     K      H
   0.323    0.140    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8167
Number of Sequences: 0
Number of extensions: 117
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of query: 298
length of database: 7197
effective HSP length: 50
effective length of query: 248
effective length of database: 7147
effective search space:  1772456
effective search space used:  1772456
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 34 (18.7 bits)
S2: 34 (17.7 bits)

END