Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: P51587
Subject Sequence ID: ENSG00000139618
Subject Sequence type: 3

Query= sp|P51587|BRCA2_HUMAN Breast cancer type 2 susceptibility
protein - Homo sapiens (Human).
         (3418 letters)

>ENSG00000139618
          Length = 84189

 Score = 3207 bits (8315), Expect = 0.0
 Identities = 1621/1648 (98%), Positives = 1622/1648 (98%)
 Frame = +1

Query: 637   GLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKE 696
             GLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKE
Sbjct: 20785 GLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKE 20964

Query: 697   KLQLFITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQ 756
             KLQLFITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQ
Sbjct: 20965 KLQLFITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQ 21144

Query: 757   KSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPME 816
             KSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPME
Sbjct: 21145 KSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPME 21324

Query: 817   KNQDVCALNENYKNVELLPPEKYMRVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVN 876
             KNQDVCALNENYKNVELLPPEKYMRVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVN
Sbjct: 21325 KNQDVCALNENYKNVELLPPEKYMRVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVN 21504

Query: 877   PDSEELFSDNENNFVFQVANERNNLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDK 936
             PDSEELFSDNENNFVFQVANERNNLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDK
Sbjct: 21505 PDSEELFSDNENNFVFQVANERNNLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDK 21684

Query: 937   QATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGL 996
             QATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGL
Sbjct: 21685 QATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGL 21864

Query: 997   LGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQ 1056
             LGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQ
Sbjct: 21865 LGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQ 22044

Query: 1057  KKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELST 1116
             KKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELST
Sbjct: 22045 KKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELST 22224

Query: 1117  ILEESGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQV 1176
             ILEESGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQV
Sbjct: 22225 ILEESGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQV 22404

Query: 1177  DSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQK 1236
             DSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQK
Sbjct: 22405 DSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQK 22584

Query: 1237  AVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQN 1296
             AVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQN
Sbjct: 22585 AVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQN 22764

Query: 1297  NIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDL 1356
             NIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDL
Sbjct: 22765 NIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDL 22944

Query: 1357  LFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACHGNTSNKEQLTATKTEQ 1416
             LFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACHGNTSNKEQLTATKTEQ
Sbjct: 22945 LFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACHGNTSNKEQLTATKTEQ 23124

Query: 1417  NIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMD 1476
             NIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMD
Sbjct: 23125 NIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMD 23304

Query: 1477  ILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAK 1536
             ILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAK
Sbjct: 23305 ILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAK 23484

Query: 1537  ESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQN 1596
             ESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQN
Sbjct: 23485 ESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQN 23664

Query: 1597  SLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYT 1656
             SLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYT
Sbjct: 23665 SLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYT 23844

Query: 1657  NQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLY 1716
             NQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLY
Sbjct: 23845 NQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLY 24024

Query: 1717  ENNSNSTIAENDKNHLSEKQDTYLXXXXXXXXXXXXXDEVYNDSGYLSKNKLDSGIEPVL 1776
             ENNSNSTIAENDKNHLSEKQDTYL             DEVYNDSGYLSKNKLDSGIEPVL
Sbjct: 24025 ENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYSYHSDEVYNDSGYLSKNKLDSGIEPVL 24204

Query: 1777  KNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNN 1836
             KNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNN
Sbjct: 24205 KNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNN 24384

Query: 1837  FEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEA 1896
             FEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEA
Sbjct: 24385 FEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEA 24564

Query: 1897  LDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSD 1956
             LDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSD
Sbjct: 24565 LDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSD 24744

Query: 1957  ICKCSIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLF 2016
             ICKCSIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLF
Sbjct: 24745 ICKCSIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLF 24924

Query: 2017  KSNEHSDQLTREENTAIRTPEHLISQKGFSYNVVNXXXXXXXXXXXXKQVSILESSLHKV 2076
             KSNEHSDQLTREENTAIRTPEHLISQKGFSYNVVN            KQVSILESSLHKV
Sbjct: 24925 KSNEHSDQLTREENTAIRTPEHLISQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKV 25104

Query: 2077  KGVLEEFDLIRTEHSLHYSPTSRQNVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNL 2136
             KGVLEEFDLIRTEHSLHYSPTSRQNVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNL
Sbjct: 25105 KGVLEEFDLIRTEHSLHYSPTSRQNVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNL 25284

Query: 2137  NVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGK 2196
             NVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGK
Sbjct: 25285 NVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGK 25464

Query: 2197  TETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTC 2256
             TETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTC
Sbjct: 25465 TETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTC 25644

Query: 2257  PENEEMVLSNSRIGKRRGEPLILVGEPS 2284
             PENEEMVLSNSRIGKRRGEPLILVG+ S
Sbjct: 25645 PENEEMVLSNSRIGKRRGEPLILVGKCS 25728



 Score =  745 bits (1924), Expect = 0.0
 Identities = 372/373 (99%), Positives = 373/373 (100%)
 Frame = +1

Query: 265   GFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVR 324
             GFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVR
Sbjct: 16792 GFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVR 16971

Query: 325   TSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEPNDTDPLDSNVAHQKPFESGSDKIS 384
             TSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEPNDTDPLDSNVA+QKPFESGSDKIS
Sbjct: 16972 TSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEPNDTDPLDSNVANQKPFESGSDKIS 17151

Query: 385   KEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSEN 444
             KEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSEN
Sbjct: 17152 KEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSEN 17331

Query: 445   SLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQGIKKS 504
             SLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQGIKKS
Sbjct: 17332 SLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQGIKKS 17511

Query: 505   IFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDNGSWP 564
             IFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDNGSWP
Sbjct: 17512 IFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDNGSWP 17691

Query: 565   ATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANA 624
             ATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANA
Sbjct: 17692 ATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANA 17871

Query: 625   FEAPLTFANADSG 637
             FEAPLTFANADSG
Sbjct: 17872 FEAPLTFANADSG 17910



 Score =  372 bits (955), Expect = e-105
 Identities = 190/202 (94%), Positives = 190/202 (94%)
 Frame = +3

Query: 3217  MSSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFXXX 3276
             MSSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDF   
Sbjct: 82683 MSSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSR 82862

Query: 3277  XXXXXXXXXICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLES 3336
                      ICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLES
Sbjct: 82863 LPLPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLES 83042

Query: 3337  NSIADEELALINTQALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQES 3396
             NSIADEELALINTQALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQES
Sbjct: 83043 NSIADEELALINTQALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQES 83222

Query: 3397  SQASTEECEKNKQDTITTKKYI 3418
             SQASTEECEKNKQDTITTKKYI
Sbjct: 83223 SQASTEECEKNKQDTITTKKYI 83288



 Score =  295 bits (754), Expect = 2e-81
 Identities = 141/145 (97%), Positives = 143/145 (98%)
 Frame = +2

Query: 2337  TTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHL 2396
             TTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHL
Sbjct: 39383 TTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHL 39562

Query: 2397  ITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQ 2456
             ITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQ
Sbjct: 39563 ITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQ 39742

Query: 2457  FNKNNSNQAAAVTFTKCEEEPLDLI 2481
             FNKNNSNQA AVTFTKCEEEPL ++
Sbjct: 39743 FNKNNSNQAVAVTFTKCEEEPLGIV 39817



 Score =  238 bits (606), Expect = 2e-64
 Identities = 122/140 (87%), Positives = 130/140 (92%)
 Frame = +1

Query: 2640  KEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSAN 2699
             K++ +R   P+  +    +RYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSAN
Sbjct: 47641 KQWNSRVTLPKICIFVFTFRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSAN 47820

Query: 2700  ISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELV 2759
             ISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELV
Sbjct: 47821 ISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELV 48000

Query: 2760  GSPDACTPLEAPESLMLKIS 2779
             GSPDACTPLEAPESLMLK++
Sbjct: 48001 GSPDACTPLEAPESLMLKVN 48060



 Score =  190 bits (482), Expect = 5e-50
 Identities = 103/138 (74%), Positives = 105/138 (76%), Gaps = 31/138 (22%)
 Frame = +1

Query: 2984  SVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLP---- 3039
             +VILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLP    
Sbjct: 64267 TVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVQTF 64446

Query: 3040  ---------------------------VSDEILFQIYQPREPLHFSKFLDPDFQPSCSEV 3072
                                        VSDEILFQIYQPREPLHFSKFLDPDFQPSCSEV
Sbjct: 64447 HCNFSVLISAC*FMESPYVEFLFCFL*VSDEILFQIYQPREPLHFSKFLDPDFQPSCSEV 64626

Query: 3073  DLIGFVVSVVKKTGLAPF 3090
             DLIGFVVSVVKKTG A +
Sbjct: 64627 DLIGFVVSVVKKTGNAQY 64680



 Score =  177 bits (450), Expect = 3e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 23   DLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSYNQLASTPIIFK 82
            DLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSYNQLASTPIIFK
Sbjct: 3597 DLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSYNQLASTPIIFK 3776

Query: 83   EQGLTLPLYQSPVKELDKFKLDLGR 107
            EQGLTLPLYQSPVKELDKFKLDLG+
Sbjct: 3777 EQGLTLPLYQSPVKELDKFKLDLGK 3851



 Score =  171 bits (433), Expect = 3e-44
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +3

Query: 3086  GLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSV 3145
             GLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSV
Sbjct: 79209 GLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSV 79388

Query: 3146  FSASPKEGHFQETFNKMKNTVE 3167
             FSASPKEGHFQETFNKMKNTVE
Sbjct: 79389 FSASPKEGHFQETFNKMKNTVE 79454



 Score =  138 bits (348), Expect = 2e-34
 Identities = 63/63 (100%), Positives = 63/63 (100%)
 Frame = +2

Query: 2540  LYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEE 2599
             LYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEE
Sbjct: 42263 LYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEE 42442

Query: 2600  FYR 2602
             FYR
Sbjct: 42443 FYR 42451



 Score =  132 bits (332), Expect = 1e-32
 Identities = 66/67 (98%), Positives = 67/67 (100%)
 Frame = +1

Query: 2918  EGYFSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSY 2977
             +GYFSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSY
Sbjct: 63835 QGYFSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSY 64014

Query: 2978  SKKEKDS 2984
             SKKEKDS
Sbjct: 64015 SKKEKDS 64035



 Score =  130 bits (326), Expect = 7e-32
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +2

Query: 2601  YRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYR 2659
             +RALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYR
Sbjct: 47039 FRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYR 47215



 Score =  123 bits (309), Expect = 6e-30
 Identities = 61/63 (96%), Positives = 63/63 (100%)
 Frame = +1

Query: 2478  LDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSH 2537
             +DLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSH
Sbjct: 40945 IDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSH 41124

Query: 2538  KQL 2540
             KQ+
Sbjct: 41125 KQV 41133



 Score =  112 bits (281), Expect = 1e-26
 Identities = 52/60 (86%), Positives = 55/60 (91%)
 Frame = +2

Query: 3168  NIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSPNCEIYYQ 3227
             NIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLL+S    + YY+
Sbjct: 81419 NIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLVS*CKLKEYYK 81598



 Score = 82.4 bits (202), Expect = 2e-17
 Identities = 40/40 (100%), Positives = 40/40 (100%)
 Frame = +2

Query: 2879  NTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLE 2918
             NTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLE
Sbjct: 61193 NTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLE 61312



 Score = 80.1 bits (196), Expect = 8e-17
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = +2

Query: 228   NVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHG 265
             NVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHG
Sbjct: 15440 NVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHG 15553



 Score = 77.4 bits (189), Expect = 5e-16
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = +2

Query: 106  GRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSE 141
            GRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSE
Sbjct: 9596 GRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSE 9703



 Score = 70.1 bits (170), Expect = 8e-14
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +2

Query: 2280  VGEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGTI 2315
             +GEPSIKRNLLNEFDRIIENQEKSLKASKSTPDG I
Sbjct: 29075 LGEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGKI 29182



 Score = 57.8 bits (138), Expect = 4e-10
 Identities = 30/54 (55%), Positives = 32/54 (59%)
 Frame = +2

Query: 2776  LKISANSTRPARWYTKXXXXXXXXXXXXXXXXXXXXXXNVGCVDVIIQRAYPIQ 2829
             ++ISANSTRPARWYTK                      NVGCVDVIIQRAYPIQ
Sbjct: 54917 VQISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQRAYPIQ 55078



 Score = 55.1 bits (131), Expect = 3e-09
 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Frame = +3

Query: 2313  GTIKDRRLFMHHVSLEPITCVPFR 2336
             GTIKDRRLFMHHVSLEPITCVPFR
Sbjct: 31347 GTIKDRRLFMHHVSLEPITCVPFR 31418



 Score = 50.8 bits (120), Expect = 5e-08
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = +1

Query: 1    MPIGSKERPTFFEIFKTRCNKADL 24
            MPIGSKERPTFFEIFKTRCNKA +
Sbjct: 982  MPIGSKERPTFFEIFKTRCNKAGI 1053



 Score = 49.7 bits (117), Expect = 1e-07
 Identities = 25/43 (58%), Positives = 26/43 (60%)
 Frame = +1

Query: 2828  IQWMEKTSSGLYIFRNXXXXXXXXXXXXXXXXXRLEALFTKIQ 2870
             +QWMEKTSSGLYIFRN                 RLEALFTKIQ
Sbjct: 55471 LQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQ 55599



 Score = 48.5 bits (114), Expect = 3e-07
 Identities = 24/44 (54%), Positives = 26/44 (59%)
 Frame = +1

Query: 172   KGRQTPKHISESLGAEVDPDMXXXXXXXXXXXXXXXVLIVRNEE 215
             +GRQTPKHISESLGAEVDPDM               VLI  N +
Sbjct: 11017 QGRQTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGNNSK 11148



 Score = 39.7 bits (91), Expect = 1e-04
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = +1

Query: 209   LIVRNEEASETVFPHDTTA 227
             L VRNEEASETVFPHDTTA
Sbjct: 13957 LTVRNEEASETVFPHDTTA 14013



 Score = 39.7 bits (91), Expect(2) = 4e-09
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +3

Query: 142   SPVVLQCTHVTPQRDKS 158
             SPVVLQCTHVTPQRDKS
Sbjct: 10620 SPVVLQCTHVTPQRDKS 10670



 Score = 34.3 bits (77), Expect(2) = 4e-09
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +1

Query: 159   VVCGSLFHTPKFVK 172
             VVCGSLFHTPKFVK
Sbjct: 10762 VVCGSLFHTPKFVK 10803


Lambda     K      H
   0.311    0.128    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 301,280
Number of Sequences: 0
Number of extensions: 4369
Number of successful extensions: 48
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of query: 3418
length of database: 28,063
effective HSP length: 78
effective length of query: 3340
effective length of database: 27,985
effective search space: 93469900
effective search space used: 93469900
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 49 (23.5 bits)

END