Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_075461.1
Subject Sequence ID: ENSG00000141837
Subject Sequence type: 3

Query= gi|13386498|ref|NP_075461.1| calcium channel, alpha 1A subunit
isoform 2; calcium channel, L type, alpha-1 polypeptide, isoform 4;
brain calcium channel 1 [Homo sapiens]
         (2505 letters)

>ENSG00000141837
          Length = 298924

 Score =  424 bits (1090), Expect = e-120
 Identities = 209/257 (81%), Positives = 209/257 (81%)
 Frame = -2

Query: 762   KEQQKNQKPAKSVWEQRTSEMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLD 821
             KEQQKNQKPAKSVWEQRTSEMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLD
Sbjct: 92052 KEQQKNQKPAKSVWEQRTSEMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLD 91873

Query: 822   RPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDAR 881
             RPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDAR
Sbjct: 91872 RPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDAR 91693

Query: 882   RPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHXXXXXX 941
             RPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVH      
Sbjct: 91692 RPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSR 91513

Query: 942   XXXXXXXXXXADGEHRRHRAHRRPGEEGPEDKAERRARHXXXXXXXXXXXXXXXXXXXXX 1001
                       ADGEHRRHRAHRRPGEEGPEDKAERRARH                     
Sbjct: 91512 ESRSGSPRTGADGEHRRHRAHRRPGEEGPEDKAERRARHREGSRPARGGEGEGEGPDGGE 91333

Query: 1002  XXXXXXXXXXXTYEGDA 1018
                        TYEGDA
Sbjct: 91332 RRRRHRHGAPATYEGDA 91282



 Score =  397 bits (1021), Expect = e-112
 Identities = 188/222 (84%), Positives = 188/222 (84%), Gaps = 2/222 (0%)
 Frame = -2

Query: 2286 QLPQTPSTPRPHVSYSPVIRKAGGSGPPXXXXXXXXXXX--AVARPGRAATSGPRRYPGP 2343
            QLPQTPSTPRPHVSYSPVIRKAGGSGPP             AVARPGRAATSGPRRYPGP
Sbjct: 681  QLPQTPSTPRPHVSYSPVIRKAGGSGPPQQQQQQQQQQQQQAVARPGRAATSGPRRYPGP 502

Query: 2344 TAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGPPGP 2403
            TAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGPPGP
Sbjct: 501  TAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGPPGP 322

Query: 2404 RHHGYYRGSDYXXXXXXXXXXXXXXXXXXXXXPPPVRHASSGATGRSPRTPRASGPACAS 2463
            RHHGYYRGSDY                     PPPVRHASSGATGRSPRTPRASGPACAS
Sbjct: 321  RHHGYYRGSDYDEADGPGSGGGEEAMAGAYDAPPPVRHASSGATGRSPRTPRASGPACAS 142

Query: 2464 PSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSESDDDWC 2505
            PSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSESDDDWC
Sbjct: 141  PSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSESDDDWC 16



 Score =  266 bits (680), Expect = 2e-72
 Identities = 133/153 (86%), Positives = 133/153 (86%)
 Frame = -2

Query: 1033  NQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLP 1092
             NQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLP
Sbjct: 79662 NQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLP 79483

Query: 1093  QSPAKMGNSTDPGPMLAIPAMATNPQNAAXXXXXXXXXXXXXXXXXXXXENSLIVTNPSG 1152
             QSPAKMGNSTDPGPMLAIPAMATNPQNAA                    ENSLIVTNPSG
Sbjct: 79482 QSPAKMGNSTDPGPMLAIPAMATNPQNAASRRTPNNPGNPSNPGPPKTPENSLIVTNPSG 79303

Query: 1153  TQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQ 1185
             TQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQ
Sbjct: 79302 TQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQ 79204



 Score =  163 bits (412), Expect = 2e-41
 Identities = 84/120 (70%), Positives = 84/120 (70%), Gaps = 36/120 (30%)
 Frame = -1

Query: 1981 QDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGAL---------------------- 2018
            QDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGAL                      
Sbjct: 5443 QDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGAL*VSPLPGRWSVGVPWSPRSGSC 5264

Query: 2019 --------------MAHESGLKESPSWVTQRAQEMFQKTGTWSPEQGPPTDMPNSQPNSQ 2064
                          MAHESGLKESPSWVTQRAQEMFQKTGTWSPEQGPPTDMPNSQPNSQ
Sbjct: 5263 PSAHCYPGLCPPCRMAHESGLKESPSWVTQRAQEMFQKTGTWSPEQGPPTDMPNSQPNSQ 5084



 Score =  151 bits (382), Expect = 6e-38
 Identities = 67/69 (97%), Positives = 68/69 (98%)
 Frame = -1

Query: 262    DDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWT 321
              DDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWT
Sbjct: 152500 DDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWT 152321

Query: 322    DLLYNSNDA 330
              DLLYN +DA
Sbjct: 152320 DLLYNVSDA 152294



 Score =  145 bits (366), Expect = 4e-36
 Identities = 71/85 (83%), Positives = 71/85 (83%)
 Frame = -2

Query: 2177 GLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQXXXXXXXXXXXXXXDKDRYAQERPDH 2236
            GLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQ              DKDRYAQERPDH
Sbjct: 1710 GLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHHPPPPDKDRYAQERPDH 1531

Query: 2237 GRARARDQRWSRSPSEGREHMAHRQ 2261
            GRARARDQRWSRSPSEGREHMAHRQ
Sbjct: 1530 GRARARDQRWSRSPSEGREHMAHRQ 1456



 Score =  145 bits (366), Expect = 4e-36
 Identities = 70/70 (100%), Positives = 70/70 (100%)
 Frame = -2

Query: 450    GSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHY 509
              GSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHY
Sbjct: 110022 GSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHY 109843

Query: 510    NQPEWLSDFL 519
              NQPEWLSDFL
Sbjct: 109842 NQPEWLSDFL 109813



 Score =  124 bits (311), Expect = 1e-29
 Identities = 66/101 (65%), Positives = 66/101 (65%), Gaps = 1/101 (0%)
 Frame = -1

Query: 1      MARFGDEMPARYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMYKQSMAQRARTMA 60
              MARFGDEMPARY                                  MYKQSMAQRARTMA
Sbjct: 298924 MARFGDEMPARYGGGGSGAAAGVVVGSGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA 298745

Query: 61     LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWP-PF 100
              LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWP PF
Sbjct: 298744 LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPYPF 298622



 Score =  116 bits (290), Expect = 3e-27
 Identities = 55/56 (98%), Positives = 56/56 (100%)
 Frame = -1

Query: 1531  ERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMK 1586
             +RACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMK
Sbjct: 47962 QRACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMK 47795



 Score =  114 bits (284), Expect = 1e-26
 Identities = 51/54 (94%), Positives = 53/54 (98%)
 Frame = -1

Query: 1749  LFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLM 1802
             + RSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFL+
Sbjct: 24568 VLRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLV 24407



 Score =  114 bits (284), Expect = 1e-26
 Identities = 54/55 (98%), Positives = 55/55 (100%)
 Frame = -1

Query: 1364  KAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCR 1418
             +AVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCR
Sbjct: 54313 QAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCR 54149



 Score =  105 bits (263), Expect = 3e-24
 Identities = 47/47 (100%), Positives = 47/47 (100%)
 Frame = -3

Query: 1418  RGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQ 1464
             RGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQ
Sbjct: 52403 RGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQ 52263



 Score =  103 bits (256), Expect = 2e-23
 Identities = 48/50 (96%), Positives = 49/50 (98%)
 Frame = -2

Query: 134    DDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTGILA 183
              DDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG +A
Sbjct: 245715 DDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG*VA 245566



 Score = 95.9 bits (237), Expect = 4e-21
 Identities = 46/49 (93%), Positives = 47/49 (95%)
 Frame = -2

Query: 1228  STTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNV 1276
             S +N LRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNV
Sbjct: 76110 SVSNSLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNV 75964



 Score = 92.4 bits (228), Expect = 4e-20
 Identities = 57/109 (52%), Positives = 57/109 (52%), Gaps = 51/109 (46%)
 Frame = -3

Query: 662   FQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNY------------------ 703
             FQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGN                   
Sbjct: 96590 FQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNCILHGEREGDRPGPLAEER 96411

Query: 704   ---------------------------------TLLNVFLAIAVDNLAN 719
                                              TLLNVFLAIAVDNLAN
Sbjct: 96410 LQGLKGGY*ETQIPRAQVVSHQWLLFLTQTFADTLLNVFLAIAVDNLAN 96264



 Score = 92.0 bits (227), Expect = 5e-20
 Identities = 48/68 (70%), Positives = 49/68 (72%)
 Frame = -2

Query: 1464  QVLKHSVDATFENQGPSPGYRMEMSXXXXXXXXXXXXXXXXXXXALIIITFQEQGDKMME 1523
             +VLKHSVDATFENQGPSPGYRMEMS                   ALIIITFQEQGDKMME
Sbjct: 50253 RVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMME 50074

Query: 1524  EYSLEKNE 1531
             EYSLEKNE
Sbjct: 50073 EYSLEKNE 50050



 Score = 90.9 bits (224), Expect = 1e-19
 Identities = 54/103 (52%), Positives = 61/103 (59%), Gaps = 8/103 (7%)
 Frame = -3

Query: 2115 TISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQXXXXXXXXXXXXXXXXXLGRYTDV 2174
            TISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQ                 LGRYTDV
Sbjct: 2198 TISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRSHRASERSLGRYTDV 2019

Query: 2175 DTG---LGTDLSMTTQSGDLPSKE-----RDQERGRPKDRKHR 2209
            DTG    G       + G+   ++     +++ER RP  R  R
Sbjct: 2018 DTGGQPCGAQGQAEQRRGEGRRRQGGGDTKEEERERPPWRGDR 1890



 Score = 90.9 bits (224), Expect = 1e-19
 Identities = 42/42 (100%), Positives = 42/42 (100%)
 Frame = -1

Query: 1802  MLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAA 1843
             MLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAA
Sbjct: 22909 MLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAA 22784



 Score = 86.7 bits (213), Expect = 2e-18
 Identities = 39/40 (97%), Positives = 39/40 (97%)
 Frame = -3

Query: 519    LYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGV 558
              L YAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGV
Sbjct: 105485 LDYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGV 105366



 Score = 86.3 bits (212), Expect = 3e-18
 Identities = 50/96 (52%), Positives = 56/96 (58%)
 Frame = -3

Query: 2007 LPSTQLDPGGALMAHESGLKESPSWVTQRAQEMFQKTGTWSPEQGPPTDMPNSQPNSQSV 2066
            LP+    PGG+      G    P      +    Q  G W         +P++    QSV
Sbjct: 5066 LPNGSQGPGGS-----GGRDLGPPHTHTCSSLPLQTPGIWRSGPRAHLALPSAP---QSV 4911

Query: 2067 EMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQ 2102
            EMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQ
Sbjct: 4910 EMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQ 4803



 Score = 81.6 bits (200), Expect = 7e-17
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = -1

Query: 360    SGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVI 403
              S EFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKA E +
Sbjct: 127198 SREFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAGEAL 127067



 Score = 77.0 bits (188), Expect = 2e-15
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = -1

Query: 1912 GGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHK 1947
            GGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHK
Sbjct: 7309 GGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHK 7202



 Score = 76.3 bits (186), Expect = 3e-15
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = -3

Query: 327    SNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSG 361
              SNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSG
Sbjct: 128609 SNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSG 128505



 Score = 75.9 bits (185), Expect = 4e-15
 Identities = 36/37 (97%), Positives = 37/37 (100%)
 Frame = -1

Query: 1295  KMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFT 1331
             +MIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFT
Sbjct: 68659 QMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFT 68549



 Score = 75.1 bits (183), Expect = 7e-15
 Identities = 37/37 (100%), Positives = 37/37 (100%)
 Frame = -2

Query: 1587  FYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGIL 1623
             FYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGIL
Sbjct: 45801 FYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGIL 45691



 Score = 75.1 bits (183), Expect = 7e-15
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -3

Query: 558    VIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTK 595
              VIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTK
Sbjct: 101228 VIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTK 101115



 Score = 74.3 bits (181), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = -2

Query: 99     PFEYMILATIIANCIVLALEQHLPDDDKTPMSERL 133
              PFEYMILATIIANCIVLALEQHLPDDDKTPMSERL
Sbjct: 247911 PFEYMILATIIANCIVLALEQHLPDDDKTPMSERL 247807



 Score = 73.6 bits (179), Expect = 2e-14
 Identities = 38/58 (65%), Positives = 40/58 (68%), Gaps = 9/58 (15%)
 Frame = -3

Query: 1828  HLDEYVRVWAEYDPAAC---------GRIHYKDMYSLLRVISPPLGLGKKCPHRVACK 1876
             H D  V   +  +P AC         GRIHYKDMYSLLRVISPPLGLGKKCPHRVACK
Sbjct: 21572 HHDLAVCPGSPCEPIACTNPLSSPFSGRIHYKDMYSLLRVISPPLGLGKKCPHRVACK 21399



 Score = 72.8 bits (177), Expect = 3e-14
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = -2

Query: 1877  RLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKG 1912
             RLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKG
Sbjct: 17472 RLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKG 17365



 Score = 69.7 bits (169), Expect = 3e-13
 Identities = 36/44 (81%), Positives = 38/44 (86%)
 Frame = -3

Query: 1940 DLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQDR 1983
            +L V    +TDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQ R
Sbjct: 7058 ELTVCVPPATDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQVR 6927



 Score = 68.6 bits (166), Expect = 6e-13
 Identities = 34/37 (91%), Positives = 35/37 (94%)
 Frame = -3

Query: 1328  FAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLK 1364
             F  +GNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLK
Sbjct: 55544 FLHSGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLK 55434



 Score = 64.3 bits (155), Expect = 1e-11
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = -1

Query: 419    GALRRTTIKKSKTDLLNPEEAEDQLADIASVG 450
              GALRRTTIKKSKTDLLNPEEAEDQLADIASVG
Sbjct: 123037 GALRRTTIKKSKTDLLNPEEAEDQLADIASVG 122942



 Score = 62.0 bits (149), Expect = 6e-11
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = -2

Query: 1624  NYFRDAWNIFDFVTVLGSITDILVTEFG 1651
             NYFRDAWNIFDFVTVLGSITDILVTEFG
Sbjct: 37965 NYFRDAWNIFDFVTVLGSITDILVTEFG 37882



 Score = 61.6 bits (148), Expect = 8e-11
 Identities = 32/38 (84%), Positives = 34/38 (89%)
 Frame = -2

Query: 174    FVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSGIPS 211
              F ++   ILATVGTEFDLRTLRAVRVLRPLKLVSGIPS
Sbjct: 164499 FWLLSFSILATVGTEFDLRTLRAVRVLRPLKLVSGIPS 164386



 Score = 61.2 bits (147), Expect = 1e-10
 Identities = 31/52 (59%), Positives = 31/52 (59%)
 Frame = -1

Query: 210    PSLQVVLKSIMKAMIPXXXXXXXXXXXXXXXXXXXXEFYMGKFHTTCFEEGT 261
              P LQVVLKSIMKAMIP                    EFYMGKFHTTCFEEGT
Sbjct: 158173 PGLQVVLKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGT 158018



 Score = 58.9 bits (141), Expect = 5e-10
 Identities = 29/40 (72%), Positives = 29/40 (72%)
 Frame = -1

Query: 1712  QVFGNIGIXXXXXXXXXXXFQITEHNNFRTFFQALMLLFR 1751
             QVFGNIGI           FQITEHNNFRTFFQALMLLFR
Sbjct: 27739 QVFGNIGIDVEDEDSDEDEFQITEHNNFRTFFQALMLLFR 27620



 Score = 57.0 bits (136), Expect = 2e-09
 Identities = 24/26 (92%), Positives = 26/26 (100%)
 Frame = -3

Query: 639    QFNFDEGTPPTNFDTFPAAIMTVFQI 664
              +FNFDEGTPPTNFDTFPAAIMTVFQ+
Sbjct: 100556 RFNFDEGTPPTNFDTFPAAIMTVFQV 100479



 Score = 53.1 bits (126), Expect = 3e-08
 Identities = 28/52 (53%), Positives = 34/52 (65%)
 Frame = -2

Query: 1842  AACGRIHYKDMYSLLRVISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHF 1893
             AA GR+ Y DMY +LR +SPPLGLGKKCP RVA K    +D P     + H+
Sbjct: 20235 AARGRMPYLDMYQMLRHMSPPLGLGKKCPARVAYK----VDYPCRPPTSRHW 20092



 Score = 50.4 bits (119), Expect = 2e-07
 Identities = 24/26 (92%), Positives = 25/26 (96%)
 Frame = -3

Query: 1688  SFKALPYVCLLIAMLFFIYAIIGMQV 1713
             S +ALPYVCLLIAMLFFIYAIIGMQV
Sbjct: 27983 SHQALPYVCLLIAMLFFIYAIIGMQV 27906



 Score = 50.4 bits (119), Expect = 2e-07
 Identities = 23/46 (50%), Positives = 31/46 (67%)
 Frame = -2

Query: 1284   FTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFA 1329
              F G+F FE  IK+I LG   H+G+Y R+ WN++DF+VV    VA A
Sbjct: 245697 FIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG*VARA 245560



 Score = 48.5 bits (114), Expect = 7e-07
 Identities = 24/45 (53%), Positives = 24/45 (53%)
 Frame = -3

Query: 1652  NNFINXXXXXXXXXXXXXXXXXQGYTIRILLWTFVQSFKALPYVC 1696
             NNFIN                 QGYTIRILLWTFVQSFK  P  C
Sbjct: 28430 NNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKVSPRPC 28296



 Score = 48.5 bits (114), Expect = 7e-07
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = -1

Query: 397    SKAEEVILAEDETDGEQRHPFDGALRRTT 425
              S +EEVILAEDETDGEQRHPFDG   + T
Sbjct: 125635 SSSEEVILAEDETDGEQRHPFDGNCSKPT 125549



 Score = 45.8 bits (107), Expect = 4e-06
 Identities = 23/34 (67%), Positives = 25/34 (73%)
 Frame = -2

Query: 1263  AEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKM 1296
             A DP+        VLRYFDYVFTGVFTFEMVIK+
Sbjct: 69867 ASDPLLSCFYPLQVLRYFDYVFTGVFTFEMVIKV 69766



 Score = 38.1 bits (87), Expect = 9e-04
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = -1

Query: 151   KIIALGFAFHKGSYLRNGWNVMDFVVVLTGILA 183
             ++I LG   H+G+Y R+ WN++DF+VV   ++A
Sbjct: 68659 QMIDLGLVLHQGAYFRDLWNILDFIVVSGALVA 68561



 Score = 36.2 bits (82), Expect = 0.003
 Identities = 23/55 (41%), Positives = 24/55 (43%)
 Frame = -2

Query: 1178  PLNHTVVQVNKNANXXXXXXXXXXXXXXXXXXXXXXXXXXMPPYSSMFILSTTNP 1232
             P+   V  VNKNAN                          MPPYSSMFILSTTNP
Sbjct: 77931 PVLVLVPTVNKNANPDPLPKKEEEKKEEEEDDRGEDGPKPMPPYSSMFILSTTNP 77767



 Score = 34.3 bits (77), Expect = 0.013
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%)
 Frame = -2

Query: 1605   FTSLFSLECVLKVMAFGIL----NYFRDAWNIFDFVTVL 1639
              F  +F  E  +K++A G      +Y R+ WN+ DFV VL
Sbjct: 245697 FIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVL 245581



 Score = 33.9 bits (76), Expect = 0.017
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = -3

Query: 745   EVAEVSPLSAANMSIAV 761
             EVAEVSPLSAANMSIAV
Sbjct: 93299 EVAEVSPLSAANMSIAV 93249



 Score = 33.9 bits (76), Expect = 0.017
 Identities = 12/33 (36%), Positives = 26/33 (78%)
 Frame = -2

Query: 1370   VVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGK 1402
              ++NS+K++ ++L +  LF+ +FA++ +QLF G+
Sbjct: 100917 LLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQ 100819



 Score = 32.7 bits (73), Expect = 0.038
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 1443   YDNVLWALLTLFTVSTGEGWPQVLKHSVDA 1472
              +DN+L+A+LT+F   T EGW  +L +  DA
Sbjct: 152383 FDNILFAVLTVFQCITMEGWTDLLYNVSDA 152294



 Score = 32.3 bits (72), Expect = 0.049
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = -1

Query: 649    TNFDTFPAAIMTVFQILTGEDWNEVMYD 676
              T FD    A++TVFQ +T E W +++Y+
Sbjct: 152389 TQFDNILFAVLTVFQCITMEGWTDLLYN 152306



 Score = 32.0 bits (71), Expect = 0.064
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -2

Query: 1308  YFRDLWNILDFIVVSGALVAFAFT 1331
             YFRD WNI DF+ V G++     T
Sbjct: 37962 YFRDAWNIFDFVTVLGSITDILVT 37891



 Score = 32.0 bits (71), Expect = 0.064
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -1

Query: 1625  YFRDAWNIFDFVTVLGSITDILVT 1648
             YFRD WNI DF+ V G++     T
Sbjct: 68620 YFRDLWNILDFIVVSGALVAFAFT 68549



 Score = 31.6 bits (70), Expect = 0.084
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -2

Query: 163   SYLRNGWNVMDFVVVLTGILATVGTEF 189
             +Y R+ WN+ DFV VL  I   + TEF
Sbjct: 37965 NYFRDAWNIFDFVTVLGSITDILVTEF 37885



 Score = 30.8 bits (68), Expect = 0.14
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = -3

Query: 191   LRTLRAVRVLRPLKLVSGIPSLQVVL 216
             +++LR +RVLRPLK +  +P L+V L
Sbjct: 55502 IKSLRVLRVLRPLKTIKRLPKLKVRL 55425



 Score = 30.8 bits (68), Expect = 0.14
 Identities = 42/163 (25%), Positives = 54/163 (33%), Gaps = 8/163 (4%)
 Frame = -1

Query: 2336  GPRRYPGPTAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPH 2395
             G R + GP   P A    P       RS    +R+ GP R+E+    + GG   P     
Sbjct: 91816 GGRAHRGPAPRPAARRGLPQETGPLPRSGPGPQRLGGPGRTEA-LGGKPGGRAEPGGTLR 91640

Query: 2396  VSEGPPGPRHHGYYRGSDYXXXXXXXXXXXXXXXXXXXXXPPPVRHASSGATGRSPRTP- 2454
                GPP P   G   G+                       PP  R  + G  G   R P 
Sbjct: 91639 PRVGPPRP---GGQPGA-------TRVLGGRGRARQGRGPPPEARAPAGGQQGEPQRVPA 91490

Query: 2455  ----RASGPACASPSRHGRRLPNGYYPAHGLA---RPRGPGSR 2490
                 R +  +  +P   G     G   A G A   +P GPG R
Sbjct: 91489 HGRGRGASTSSRAPQARGGG-SGGQGGAEGAAPRGQPAGPGRR 91364



 Score = 30.4 bits (67), Expect = 0.19
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = -3

Query: 1275   NVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILD 1317
              ++L Y +++F G+F  EM IKM  LG       YF   +N  D
Sbjct: 105491 SLLDYAEFIFLGLFMSEMFIKMYGLG----TRPYFHSSFNCFD 105375



 Score = 29.6 bits (65), Expect = 0.32
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = -3

Query: 1783   GNEFAYFYFVSFIFLCSFLMLNLFVAVI 1810
              GN + + YF+  I + SF MLNL + V+
Sbjct: 128594 GNTWNWLYFIPLIIIGSFFMLNLVLGVL 128511



 Score = 29.3 bits (64), Expect = 0.42
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -1

Query: 98    PPFEYMILATIIANCIVLALEQHLP 122
             PPFEY I+A I  N IVL ++   P
Sbjct: 47857 PPFEYTIMAMIALNTIVLMMKVSAP 47783



 Score = 29.3 bits (64), Expect = 0.42
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = -3

Query: 301   FDNILFAVLTVFQCITMEGW 320
             +DN+L+A+LT+F   T EGW
Sbjct: 52328 YDNVLWALLTLFTVSTGEGW 52269



 Score = 29.3 bits (64), Expect = 0.42
 Identities = 11/39 (28%), Positives = 26/39 (66%)
 Frame = -2

Query: 1677   TIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG 1715
              ++R L+ + + S K++  +  L+ +   ++A++GMQ+FG
Sbjct: 100941 SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFG 100825



 Score = 27.3 bits (59), Expect = 1.6
 Identities = 15/51 (29%), Positives = 17/51 (33%)
 Frame = -2

Query: 589    RIFKVTKYWAXXXXXXXXXXXXMKXXXXXXXXXXXXXXXXXXXGMQLFGGQ 639
              R+  V +YWA            MK                   GMQLFGGQ
Sbjct: 100971 RLASVGRYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQ 100819



 Score = 26.9 bits (58), Expect = 2.1
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +2

Query: 2174   VDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRK 2207
              +DTG GT+  ++ ++   PS+   Q  GRP  R+
Sbjct: 288308 LDTGKGTNKVVSGETWSFPSQTEHQISGRPTHRQ 288409



 Score = 26.9 bits (58), Expect = 2.1
 Identities = 10/43 (23%), Positives = 24/43 (55%)
 Frame = -1

Query: 1361   PKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKF 1403
              P L+ V   ++ ++  +  I ++    + IFA++ ++ + GKF
Sbjct: 158173 PGLQVVLKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMGKF 158045



 Score = 26.9 bits (58), Expect = 2.1
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = -2

Query: 1342   IKSLRVLRVLRPLKTIKRLP 1361
              +++LR +RVLRPLK +  +P
Sbjct: 164448 LRTLRAVRVLRPLKLVSGIP 164389



 Score = 26.6 bits (57), Expect = 2.7
 Identities = 20/78 (25%), Positives = 30/78 (38%), Gaps = 14/78 (17%)
 Frame = +1

Query: 866    HDRARDPSGSAGLDARRPWAGSQEAELSREGP--------------YGRESDHHAREGSL 911
              H R        G+ A R    S++   SREGP                RE   H+REG +
Sbjct: 188380 HSREGPAPYPEGMHALRDQEESRQPPYSREGPAPYPEGMHAERDQGEPREPPLHSREGLV 188559

Query: 912    EQPGFWEGEAERGKAGDP 929
                P     + ++G++  P
Sbjct: 188560 PYPEEMHAQRDQGESRQP 188613



 Score = 26.6 bits (57), Expect = 2.7
 Identities = 12/33 (36%), Positives = 14/33 (42%)
 Frame = +3

Query: 2326 VARPGRAATSGPRRYPGPTAEPLAGDRPPTGGH 2358
            V RP  +  +   R P PT  P     PP G H
Sbjct: 5640 VPRPHLSLQAPSPRSPAPTFNPTVPQEPPEGAH 5738



 Score = 26.6 bits (57), Expect = 2.7
 Identities = 16/52 (30%), Positives = 20/52 (38%)
 Frame = +3

Query: 2353 PPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGPPGPR 2404
            PP      G  PR  R       +  P A R    + PA+GP   + P G R
Sbjct: 249  PPRRPRCPGHRPRRSRSPGSSHGAGDPGAPRTRAGQMPATGPRRVDRPWGTR 404



 Score = 26.6 bits (57), Expect = 2.7
 Identities = 22/61 (36%), Positives = 24/61 (39%), Gaps = 1/61 (1%)
 Frame = +3

Query: 2437 PPVRHASSGATGR-SPRTPRASGPACASPSRHGRRLPNGYYPAHGLARPRGPGSRKGLHE 2495
            P  R   S A+ R  PRT    G A   P     R P    P H   R R PGS  G  +
Sbjct: 153  PGPRPGESWASARWRPRTRVVRGVARRRPRPWPPRRPR--CPGHRPRRSRSPGSSHGAGD 326

Query: 2496 P 2496
            P
Sbjct: 327  P 329



 Score = 26.2 bits (56), Expect = 3.5
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = -2

Query: 546   YFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISV 581
             YF  ++N FD   ++GSI +++       T FG+S+
Sbjct: 37962 YFRDAWNIFDFVTVLGSITDIL------VTEFGVSL 37873



 Score = 26.2 bits (56), Expect = 3.5
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 883    PWAGSQEAELSREGPYGRESDHH 905
              PW  SQ A + ++G Y  ESD+H
Sbjct: 226535 PWELSQAANVWKQGLYFPESDNH 226603



 Score = 25.8 bits (55), Expect = 4.6
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +3

Query: 2362   RSPRMERRVPGPARSESP 2379
              R P++  R PGPARS +P
Sbjct: 141984 RQPQINSRHPGPARSPAP 142037



 Score = 25.4 bits (54), Expect = 6.0
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +3

Query: 2010   TQLDPGGALMAHESGLKESPSWVTQRAQEMFQKTGT 2045
              T L+PGG   +       +P+WVT RA+   Q+  T
Sbjct: 271785 THLNPGGGGCSEPRSCHHTPAWVT-RAKPHLQQNRT 271889



 Score = 25.4 bits (54), Expect = 6.0
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -2

Query: 1567   PFEYTIMAMIALNTIVLMMK 1586
              PFEY I+A I  N IVL ++
Sbjct: 247911 PFEYMILATIIANCIVLALE 247852



 Score = 25.4 bits (54), Expect = 6.0
 Identities = 14/54 (25%), Positives = 18/54 (33%)
 Frame = +2

Query: 2358 HSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGPPGPRHHGYYRG 2411
            H+    P    + P    S  P   RH  A  P   PH + G      H  + G
Sbjct: 3809 HARWVLPNPRSQQPEARPSGDPGPARHSTASCPVQTPHTAHGKLATATHATHPG 3970



 Score = 25.0 bits (53), Expect = 7.8
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 5/34 (14%)
 Frame = -3

Query: 269   PAPCGTEEP----ARTC-PNGTKCQPYWEGPNNG 297
             P+PCG+  P    +RTC P G  C   W   + G
Sbjct: 92024 PSPCGSSGPVRCESRTCWPAGRPCITKWTRTSAG 91923



 Score = 25.0 bits (53), Expect = 7.8
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +1

Query: 1363  LKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESK 1411
             L+AVF  VV         L++ +LF+F +  V V    G F HC D+++
Sbjct: 77815 LRAVFPTVV--------FLLLLLLFLFFWQWVWV----GVFVHCWDKNQ 77925


Lambda     K      H
   0.321    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 909,043
Number of Sequences: 0
Number of extensions: 15675
Number of successful extensions: 195
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 181
length of query: 2505
length of database: 99,641
effective HSP length: 85
effective length of query: 2420
effective length of database: 99,556
effective search space: 240925520
effective search space used: 240925520
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

END