Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_061496.2
Subject Sequence ID: ENSG00000006283
Subject Sequence type: 3

Query= gi|20070163|ref|NP_061496.2| calcium channel,
voltage-dependent, alpha 1G subunit; calcium channel,
voltage-dependent, T type, alpha-1G subunit [Homo sapiens]
         (2377 letters)

>ENSG00000006283
          Length = 65806

 Score =  509 bits (1311), Expect = e-146
 Identities = 244/244 (100%), Positives = 244/244 (100%)
 Frame = +1

Query: 2134  AAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTP 2193
             AAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTP
Sbjct: 64558 AAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTP 64737

Query: 2194  PAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQS 2253
             PAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQS
Sbjct: 64738 PAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQS 64917

Query: 2254  CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITI 2313
             CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITI
Sbjct: 64918 CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITI 65097

Query: 2314  DPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPA 2373
             DPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPA
Sbjct: 65098 DPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPA 65277

Query: 2374  DLDP 2377
             DLDP
Sbjct: 65278 DLDP 65289



 Score =  457 bits (1175), Expect = e-130
 Identities = 233/262 (88%), Positives = 233/262 (88%)
 Frame = +2

Query: 381   VGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYL 440
             VGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYL
Sbjct: 14084 VGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYL 14263

Query: 441   VYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPXXXXXXXXXXXXXXXXXXXXXX 500
             VYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQP                      
Sbjct: 14264 VYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHRRLSVHHLVHHHHH 14443

Query: 501   XXXXXXXGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD 560
                    GNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD
Sbjct: 14444 HHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD 14623

Query: 561   CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLT 620
             CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLT
Sbjct: 14624 CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLT 14803

Query: 621   SLNIPPGPYSSMHKLLETQSTG 642
             SLNIPPGPYSSMHKLLETQSTG
Sbjct: 14804 SLNIPPGPYSSMHKLLETQSTG 14869



 Score =  265 bits (676), Expect = 9e-73
 Identities = 128/133 (96%), Positives = 128/133 (96%)
 Frame = +3

Query: 642   GACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQ 701
             GACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQ
Sbjct: 16728 GACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQ 16907

Query: 702   HSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMG 761
             HSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMG
Sbjct: 16908 HSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMG 17087

Query: 762   IEYHEQPEELTNA 774
             IEYHEQ  E   A
Sbjct: 17088 IEYHEQVGEWAEA 17126



 Score =  194 bits (492), Expect = 2e-51
 Identities = 91/101 (90%), Positives = 91/101 (90%)
 Frame = +2

Query: 250   PLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRXXXXXXXXXXLDYEAYNSSS 309
             PLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLR          LDYEAYNSSS
Sbjct: 11096 PLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGLDYEAYNSSS 11275

Query: 310   NTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV 350
             NTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV
Sbjct: 11276 NTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV 11398



 Score =  191 bits (484), Expect = 2e-50
 Identities = 93/119 (78%), Positives = 94/119 (78%)
 Frame = +1

Query: 1809  KDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHXXXXXXXXXXXXXXX 1868
             +DTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKH               
Sbjct: 57193 QDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELE 57372

Query: 1869  XXXXXXXXXXSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPT 1927
                       SPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPT
Sbjct: 57373 AELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPT 57549



 Score =  152 bits (384), Expect = 7e-39
 Identities = 81/118 (68%), Positives = 81/118 (68%)
 Frame = +1

Query: 1113  LGRAPSLKRRSPSGERRSLLXXXXXXXXXXXXXXXXXRASPAGSDHRHRGSLEREAKSSF 1172
             LGRAPSLKRRSPSGERRSLL                 RASPAGSDHRHRGSLEREAKSSF
Sbjct: 38047 LGRAPSLKRRSPSGERRSLLSGEGQESQDEEESSEEERASPAGSDHRHRGSLEREAKSSF 38226

Query: 1173  DLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGXXXXXXXXXXXXXXXXXXXXEGNL 1230
             DLPDTLQVPGLHRTASGRGSASEHQDCNGKSASG                    EGNL
Sbjct: 38227 DLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALRPDDPPLDGDDADDEGNL 38400



 Score =  129 bits (323), Expect = 8e-32
 Identities = 78/141 (55%), Positives = 87/141 (61%), Gaps = 16/141 (11%)
 Frame = +3

Query: 1954  AGPGGQPSA----FP-SAPSLGGSDPQIPLAE-----MEALSLTSEIVSEPSCSLALT-- 2001
             AGP   P       P S+P + GS   +PL+      +  LS     V     +L L+  
Sbjct: 62199 AGPADSPGCPDPLLPASSPRVEGSSMCLPLSPAMLMPISTLSWEGTGVRAGRGALLLSVV 62378

Query: 2002  -DDSLPDDMHTLLLSA---LESNMQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHG 2057
                S+    HTL L         MQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHG
Sbjct: 62379 SAASVTKPTHTLFLHLPPLFLLQMQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHG 62558

Query: 2058  STAEGPLGHRGWGLPKAQSGS 2078
             STAEGPLGHRGWGLPKAQSG+
Sbjct: 62559 STAEGPLGHRGWGLPKAQSGT 62621



 Score =  126 bits (316), Expect(2) = 2e-43
 Identities = 63/64 (98%), Positives = 64/64 (100%)
 Frame = +2

Query: 1021  ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA 1080
             A+VSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
Sbjct: 35267 AVVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA 35446

Query: 1081  HEMK 1084
             HEMK
Sbjct: 35447 HEMK 35458



 Score =  123 bits (309), Expect = 3e-30
 Identities = 57/60 (95%), Positives = 59/60 (98%)
 Frame = +2

Query: 2076  SGSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAA 2135
             +GSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQ +
Sbjct: 62897 TGSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQVS 63076



 Score =  120 bits (301), Expect = 3e-29
 Identities = 57/70 (81%), Positives = 58/70 (82%)
 Frame = +1

Query: 13  SGQPRSFMRLNDLXXXXXXXXXXXXEKDPGSADSEAEGLPYPALAPVVFFYLSQDSRPRS 72
           SGQPRSFMRLNDL            EKDPGSADSEAEGLPYPALAPVVFFYLSQDSRPRS
Sbjct: 37  SGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVVFFYLSQDSRPRS 216

Query: 73  WCLRTVCNPW 82
           WCLRTVCNP+
Sbjct: 217 WCLRTVCNPY 246



 Score =  112 bits (279), Expect = 1e-26
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 2/71 (2%)
 Frame = +1

Query: 902   DRKNFDSLLWAIVTVF--QILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL 959
             DR     L+ A++ VF  QILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL
Sbjct: 30421 DRGRQVPLV*ALIPVFCPQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL 30600

Query: 960   VAILVEGFQAE 970
             VAILVEGFQAE
Sbjct: 30601 VAILVEGFQAE 30633



 Score =  109 bits (273), Expect = 5e-26
 Identities = 49/50 (98%), Positives = 50/50 (100%)
 Frame = +3

Query: 1589  QCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQI 1638
             QCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQ+
Sbjct: 53907 QCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQV 54056



 Score =  107 bits (268), Expect = 2e-25
 Identities = 61/87 (70%), Positives = 65/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query: 1900  SPDSPKP-GALHPAAHARSASHFSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGG 1958
             SP +  P  AL P     S S + L  P DRQLFDTISLLIQGSLEWELKLMDELAGPGG
Sbjct: 58140 SPSTTLPITAL*PLLPCLSGSPYGLA-PQDRQLFDTISLLIQGSLEWELKLMDELAGPGG 58316

Query: 1959  QPSAFPSAPSLGGSDPQIPLAEMEALS 1985
             QPSAFPSAPSLGGSDPQ+ +    ALS
Sbjct: 58317 QPSAFPSAPSLGGSDPQVTVPLCCALS 58397



 Score =  104 bits (259), Expect = 2e-24
 Identities = 52/52 (100%), Positives = 52/52 (100%)
 Frame = +1

Query: 818   SVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFC 869
             SVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFC
Sbjct: 29974 SVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFC 30129



 Score =  103 bits (256), Expect = 5e-24
 Identities = 51/51 (100%), Positives = 51/51 (100%)
 Frame = +2

Query: 767   QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI 817
             QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI
Sbjct: 29009 QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI 29161



 Score = 99.0 bits (245), Expect = 9e-23
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = +3

Query: 1431  VQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQ 1474
             VQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQ
Sbjct: 44433 VQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQ 44564



 Score = 97.4 bits (241), Expect = 3e-22
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 1503  QQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQ 1547
             +QPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQ
Sbjct: 46362 RQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQ 46496



 Score = 94.4 bits (233), Expect = 2e-21
 Identities = 41/41 (100%), Positives = 41/41 (100%)
 Frame = +2

Query: 1769  ECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMK 1809
             ECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMK
Sbjct: 56762 ECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWN