Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_061496.2
Subject Sequence ID: ENSG00000006283
Subject Sequence type: 3

Query= gi|20070163|ref|NP_061496.2| calcium channel,
voltage-dependent, alpha 1G subunit; calcium channel,
voltage-dependent, T type, alpha-1G subunit [Homo sapiens]
         (2377 letters)

>ENSG00000006283
          Length = 65806

 Score =  509 bits (1311), Expect = e-146
 Identities = 244/244 (100%), Positives = 244/244 (100%)
 Frame = +1

Query: 2134  AAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTP 2193
             AAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTP
Sbjct: 64558 AAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQAQQHSRSHSKISKHMTP 64737

Query: 2194  PAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQS 2253
             PAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQS
Sbjct: 64738 PAPCPGPEPNWGKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQS 64917

Query: 2254  CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITI 2313
             CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITI
Sbjct: 64918 CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITI 65097

Query: 2314  DPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPA 2373
             DPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPA
Sbjct: 65098 DPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPA 65277

Query: 2374  DLDP 2377
             DLDP
Sbjct: 65278 DLDP 65289



 Score =  457 bits (1175), Expect = e-130
 Identities = 233/262 (88%), Positives = 233/262 (88%)
 Frame = +2

Query: 381   VGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYL 440
             VGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYL
Sbjct: 14084 VGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYL 14263

Query: 441   VYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPXXXXXXXXXXXXXXXXXXXXXX 500
             VYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQP                      
Sbjct: 14264 VYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHRRLSVHHLVHHHHH 14443

Query: 501   XXXXXXXGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD 560
                    GNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD
Sbjct: 14444 HHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHAD 14623

Query: 561   CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLT 620
             CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLT
Sbjct: 14624 CHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLT 14803

Query: 621   SLNIPPGPYSSMHKLLETQSTG 642
             SLNIPPGPYSSMHKLLETQSTG
Sbjct: 14804 SLNIPPGPYSSMHKLLETQSTG 14869



 Score =  265 bits (676), Expect = 9e-73
 Identities = 128/133 (96%), Positives = 128/133 (96%)
 Frame = +3

Query: 642   GACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQ 701
             GACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQ
Sbjct: 16728 GACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQ 16907

Query: 702   HSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMG 761
             HSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMG
Sbjct: 16908 HSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMG 17087

Query: 762   IEYHEQPEELTNA 774
             IEYHEQ  E   A
Sbjct: 17088 IEYHEQVGEWAEA 17126



 Score =  194 bits (492), Expect = 2e-51
 Identities = 91/101 (90%), Positives = 91/101 (90%)
 Frame = +2

Query: 250   PLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRXXXXXXXXXXLDYEAYNSSS 309
             PLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLR          LDYEAYNSSS
Sbjct: 11096 PLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGLDYEAYNSSS 11275

Query: 310   NTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV 350
             NTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV
Sbjct: 11276 NTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQV 11398



 Score =  191 bits (484), Expect = 2e-50
 Identities = 93/119 (78%), Positives = 94/119 (78%)
 Frame = +1

Query: 1809  KDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHXXXXXXXXXXXXXXX 1868
             +DTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKH               
Sbjct: 57193 QDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELE 57372

Query: 1869  XXXXXXXXXXSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPT 1927
                       SPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPT
Sbjct: 57373 AELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPT 57549



 Score =  152 bits (384), Expect = 7e-39
 Identities = 81/118 (68%), Positives = 81/118 (68%)
 Frame = +1

Query: 1113  LGRAPSLKRRSPSGERRSLLXXXXXXXXXXXXXXXXXRASPAGSDHRHRGSLEREAKSSF 1172
             LGRAPSLKRRSPSGERRSLL                 RASPAGSDHRHRGSLEREAKSSF
Sbjct: 38047 LGRAPSLKRRSPSGERRSLLSGEGQESQDEEESSEEERASPAGSDHRHRGSLEREAKSSF 38226

Query: 1173  DLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGXXXXXXXXXXXXXXXXXXXXEGNL 1230
             DLPDTLQVPGLHRTASGRGSASEHQDCNGKSASG                    EGNL
Sbjct: 38227 DLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALRPDDPPLDGDDADDEGNL 38400



 Score =  129 bits (323), Expect = 8e-32
 Identities = 78/141 (55%), Positives = 87/141 (61%), Gaps = 16/141 (11%)
 Frame = +3

Query: 1954  AGPGGQPSA----FP-SAPSLGGSDPQIPLAE-----MEALSLTSEIVSEPSCSLALT-- 2001
             AGP   P       P S+P + GS   +PL+      +  LS     V     +L L+  
Sbjct: 62199 AGPADSPGCPDPLLPASSPRVEGSSMCLPLSPAMLMPISTLSWEGTGVRAGRGALLLSVV 62378

Query: 2002  -DDSLPDDMHTLLLSA---LESNMQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHG 2057
                S+    HTL L         MQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHG
Sbjct: 62379 SAASVTKPTHTLFLHLPPLFLLQMQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHG 62558

Query: 2058  STAEGPLGHRGWGLPKAQSGS 2078
             STAEGPLGHRGWGLPKAQSG+
Sbjct: 62559 STAEGPLGHRGWGLPKAQSGT 62621



 Score =  126 bits (316), Expect(2) = 2e-43
 Identities = 63/64 (98%), Positives = 64/64 (100%)
 Frame = +2

Query: 1021  ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA 1080
             A+VSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
Sbjct: 35267 AVVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA 35446

Query: 1081  HEMK 1084
             HEMK
Sbjct: 35447 HEMK 35458



 Score =  123 bits (309), Expect = 3e-30
 Identities = 57/60 (95%), Positives = 59/60 (98%)
 Frame = +2

Query: 2076  SGSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAA 2135
             +GSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQ +
Sbjct: 62897 TGSVLSVHSQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQVS 63076



 Score =  120 bits (301), Expect = 3e-29
 Identities = 57/70 (81%), Positives = 58/70 (82%)
 Frame = +1

Query: 13  SGQPRSFMRLNDLXXXXXXXXXXXXEKDPGSADSEAEGLPYPALAPVVFFYLSQDSRPRS 72
           SGQPRSFMRLNDL            EKDPGSADSEAEGLPYPALAPVVFFYLSQDSRPRS
Sbjct: 37  SGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVVFFYLSQDSRPRS 216

Query: 73  WCLRTVCNPW 82
           WCLRTVCNP+
Sbjct: 217 WCLRTVCNPY 246



 Score =  112 bits (279), Expect = 1e-26
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 2/71 (2%)
 Frame = +1

Query: 902   DRKNFDSLLWAIVTVF--QILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL 959
             DR     L+ A++ VF  QILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL
Sbjct: 30421 DRGRQVPLV*ALIPVFCPQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL 30600

Query: 960   VAILVEGFQAE 970
             VAILVEGFQAE
Sbjct: 30601 VAILVEGFQAE 30633



 Score =  109 bits (273), Expect = 5e-26
 Identities = 49/50 (98%), Positives = 50/50 (100%)
 Frame = +3

Query: 1589  QCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQI 1638
             QCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQ+
Sbjct: 53907 QCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQV 54056



 Score =  107 bits (268), Expect = 2e-25
 Identities = 61/87 (70%), Positives = 65/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query: 1900  SPDSPKP-GALHPAAHARSASHFSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGG 1958
             SP +  P  AL P     S S + L  P DRQLFDTISLLIQGSLEWELKLMDELAGPGG
Sbjct: 58140 SPSTTLPITAL*PLLPCLSGSPYGLA-PQDRQLFDTISLLIQGSLEWELKLMDELAGPGG 58316

Query: 1959  QPSAFPSAPSLGGSDPQIPLAEMEALS 1985
             QPSAFPSAPSLGGSDPQ+ +    ALS
Sbjct: 58317 QPSAFPSAPSLGGSDPQVTVPLCCALS 58397



 Score =  104 bits (259), Expect = 2e-24
 Identities = 52/52 (100%), Positives = 52/52 (100%)
 Frame = +1

Query: 818   SVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFC 869
             SVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFC
Sbjct: 29974 SVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFC 30129



 Score =  103 bits (256), Expect = 5e-24
 Identities = 51/51 (100%), Positives = 51/51 (100%)
 Frame = +2

Query: 767   QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI 817
             QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI
Sbjct: 29009 QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI 29161



 Score = 99.0 bits (245), Expect = 9e-23
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = +3

Query: 1431  VQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQ 1474
             VQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQ
Sbjct: 44433 VQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQ 44564



 Score = 97.4 bits (241), Expect = 3e-22
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 1503  QQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQ 1547
             +QPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQ
Sbjct: 46362 RQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQ 46496



 Score = 94.4 bits (233), Expect = 2e-21
 Identities = 41/41 (100%), Positives = 41/41 (100%)
 Frame = +2

Query: 1769  ECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMK 1809
             ECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMK
Sbjct: 56762 ECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMK 56884



 Score = 91.7 bits (226), Expect = 1e-20
 Identities = 46/49 (93%), Positives = 47/49 (95%)
 Frame = +3

Query: 1976  IPLAEMEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPH 2024
             IPLAEMEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESN+  H
Sbjct: 60201 IPLAEMEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNVHTH 60347



 Score = 91.3 bits (225), Expect = 2e-20
 Identities = 43/46 (93%), Positives = 43/46 (93%)
 Frame = +2

Query: 1260  PPQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSA 1305
             P   RFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSA
Sbjct: 39578 PCLGRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSA 39715



 Score = 87.8 bits (216), Expect = 2e-19
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 1674  RWNQLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIAR 1718
             RWNQLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIAR
Sbjct: 55977 RWNQLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIAR 56111



 Score = 82.0 bits (201), Expect = 1e-17
 Identities = 37/37 (100%), Positives = 37/37 (100%)
 Frame = +2

Query: 82   WFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQ 118
            WFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQ
Sbjct: 7412 WFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQ 7522



 Score = 78.6 bits (192), Expect = 1e-16
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = +3

Query: 1637  QILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDR 1674
             QILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDR
Sbjct: 54813 QILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDR 54926



 Score = 77.0 bits (188), Expect = 4e-16
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +3

Query: 1231  SKGERVRAWIRARLPACCLERDSWSAYIFPPQSR 1264
             SKGERVRAWIRARLPACCLERDSWSAYIFPPQSR
Sbjct: 39267 SKGERVRAWIRARLPACCLERDSWSAYIFPPQSR 39368



 Score = 77.0 bits (188), Expect = 4e-16
 Identities = 34/35 (97%), Positives = 35/35 (100%)
 Frame = +2

Query: 885   HLFGCKFASERDGDTLPDRKNFDSLLWAIVTVFQI 919
             HLFGCKFASERDGDTLPDRKNFDSLLWAIVTVFQ+
Sbjct: 30293 HLFGCKFASERDGDTLPDRKNFDSLLWAIVTVFQV 30397



 Score = 73.6 bits (179), Expect = 4e-15
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 130  VEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAG 163
            VEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAG
Sbjct: 7739 VEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAG 7840



 Score = 70.1 bits (170), Expect = 4e-14
 Identities = 47/114 (41%), Positives = 47/114 (41%), Gaps = 42/114 (36%)
 Frame = +3

Query: 1302  PHSAERIFLTLSNYIFTAVFLAEMTVK--------------------------------- 1328
             P   ERIFLTLSNYIFTAVFLAEMTVK                                 
Sbjct: 41349 PLLQERIFLTLSNYIFTAVFLAEMTVKVMGAGVGLGPLVPGGGGDSLG*GWEGWLQRREG 41528

Query: 1329  ---------VVALGWCFGEQAYLRSSWNXXXXXXXXXXXXXXXXXXXXXXGTKI 1373
                      VVALGWCFGEQAYLRSSWN                      GTKI
Sbjct: 41529 GR*RGGGPQVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKI 41690



 Score = 65.5 bits (158), Expect = 1e-12
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +3

Query: 1474  QALMSLFVLASKDGWVDIMYDGLDAVGVDQQ 1504
             QALMSLFVLASKDGWVDIMYDGLDAVGVDQQ
Sbjct: 45438 QALMSLFVLASKDGWVDIMYDGLDAVGVDQQ 45530



 Score = 65.5 bits (158), Expect = 1e-12
 Identities = 33/33 (100%), Positives = 33/33 (100%)
 Frame = +1

Query: 164  MLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPS 196
            MLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPS
Sbjct: 8248 MLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPS 8346



 Score = 62.8 bits (151), Expect(2) = 2e-43
 Identities = 28/28 (100%), Positives = 28/28 (100%)
 Frame = +3

Query: 994   GDANKSESEPDFFSPSLDGDGDRKKCLA 1021
             GDANKSESEPDFFSPSLDGDGDRKKCLA
Sbjct: 35103 GDANKSESEPDFFSPSLDGDGDRKKCLA 35186



 Score = 55.8 bits (133), Expect = 9e-10
 Identities = 29/53 (54%), Positives = 29/53 (54%)
 Frame = +2

Query: 197   MRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQLWAGLLRNRCFLPENFSL 249
             MRI            GNVLLLC            QLWAGLLRNRCFLPENFSL
Sbjct: 10421 MRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSL 10579



 Score = 50.4 bits (119), Expect = 4e-08
 Identities = 26/33 (78%), Positives = 28/33 (84%)
 Frame = +2

Query: 1711  MRVLRIARVLKLLKMAVGMRALLDTVMQALPQV 1743
             +  L  + VLKLLKMAVGMRALLDTVMQALPQV
Sbjct: 56375 LMTLSCSAVLKLLKMAVGMRALLDTVMQALPQV 56473



 Score = 49.7 bits (117), Expect = 6e-08
 Identities = 28/43 (65%), Positives = 29/43 (67%)
 Frame = +1

Query: 1391  VISRAQGLKLVVETLMSSLKPIGNXXXXXXXXXXXXXXLGVQL 1433
             VISRAQGLKLVVETLMSSLKPIGN              LGVQ+
Sbjct: 42697 VISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQV 42825



 Score = 48.9 bits (115), Expect = 1e-07
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = +3

Query: 971   EISKREDASGQLSCIQLPVDSQG 993
             EISKREDASGQLSCIQLPVDSQG
Sbjct: 33534 EISKREDASGQLSCIQLPVDSQG 33602



 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +3

Query: 350   VITLEGWVDIMYFVMDAHS 368
             VITLEGWVDIMYFVMDAHS
Sbjct: 11562 VITLEGWVDIMYFVMDAHS 11618



 Score = 39.7 bits (91), Expect = 6e-05
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +2

Query: 1635  QPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLL 1685
             QP+ L  AL+I N +FT +F LE + KL+ +G   + ++ +N  D  IV++
Sbjct: 29009 QPEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVI 29161



 Score = 38.1 bits (87), Expect = 2e-04
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 5/58 (8%)
 Frame = +3

Query: 797   YGPFGYIKNPYNIFDGVIVVISVWEI----VGQQGGG-LSVLRTFRLMRVLKLVRFLP 849
             +G   Y+++ +N+ DG++V+ISV +I    V   G   L +LR  RL+R L+ +R LP
Sbjct: 41577 FGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLR*LP 41750



 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 5/66 (7%)
 Frame = +3

Query: 135   KMVALG-IFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVS----FSAVRTVRVLRPLR 189
             ++VALG  FG++ YL  +WN LD  +V+  +++  + + + S       +R +R+LR LR
Sbjct: 41553 QVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLR 41732

Query: 190   AINRVP 195
              +  +P
Sbjct: 41733 PLR*LP 41750



 Score = 35.4 bits (80), Expect = 0.001
 Identities = 40/147 (27%), Positives = 56/147 (38%), Gaps = 3/147 (2%)
 Frame = -3

Query: 2230  PPGGQE---EPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTD 2286
             PPG Q     PP P+  +    + AQSC+       DE+++H       +    PHL   
Sbjct: 56717 PPGLQPWLLHPPLPQLTQVSKELHAQSCK-------DEKQQHE------EKSQVPHLEKR 56577

Query: 2287  PSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKDPLAS 2346
               N            P + L  PS+   PP  Q P T   PG       P+S    P A 
Sbjct: 56576 RRNRNDA-----AGSPSQLL*APSLWKAPPPPQRPPTSRLPG-----AGPASPC--PAAP 56433

Query: 2347  GPPDSMAASPSPKKDVLSLSGLSSDPA 2373
               P   +A+ + +    S +GL   PA
Sbjct: 56432 ACPQPSSAASALQNRTTS*AGLFGSPA 56352



 Score = 35.4 bits (80), Expect = 0.001
 Identities = 21/48 (43%), Positives = 28/48 (58%)
 Frame = +2

Query: 1300 IDPHSAERIFLTLSNYIFTAVFLAEMTVKVVALGWCFGEQAYLRSSWN 1347
            + PH A        ++IF A F  EM VK+VALG  FG++ YL  +WN
Sbjct: 7691 LSPHQA------FDDFIF-AFFAVEMVVKMVALG-IFGKKCYLGDTWN 7810



 Score = 33.5 bits (75), Expect = 0.005
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +3

Query: 1263  SRFRLLCHRIITHKMFDHVVLVIIFLNCITIAME 1296
             SRFRLL H + T    D  +  +I LN +T+AME
Sbjct: 53934 SRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAME 54035



 Score = 32.0 bits (71), Expect = 0.013
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 1599  RFRLLVHHLCTSHYLDLFITGVIGLNVVTMAME 1631
             RFRLL H + T    D  +  +I LN +T+AME
Sbjct: 39590 RFRLLCHRIITHKMFDHVVLVIIFLNCITIAME 39688



 Score = 31.2 bits (69), Expect = 0.023
 Identities = 33/95 (34%), Positives = 37/95 (38%), Gaps = 1/95 (1%)
 Frame = +1

Query: 2284  GTDPSNLGGQPLG-GPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKD 2342
             GTD     G   G GPG+ P   L    +   P +  GP TPP  G       P S S  
Sbjct: 29179 GTDSQLRNGSRGGLGPGAMPPIPLGWRGLESGPTDPTGPATPPRWGALCVPMPPPSLSWP 29358

Query: 2343  PLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP 2377
              LA  P D    S  P+     LS L   P  LDP
Sbjct: 29359 HLA--PVDLGLTSSLPRPLFSLLSPLL--PLVLDP 29451



 Score = 30.8 bits (68), Expect = 0.030
 Identities = 34/129 (26%), Positives = 49/129 (37%), Gaps = 15/129 (11%)
 Frame = -1

Query: 2084  SQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDV 2143
             S PA  S  + +P   P      S P    +  + PPG  P  QR  + +A     +   
Sbjct: 24232 SSPAPGSSPVWIPPPVP------SCPLGTLLGVMVPPG--PPNQRQCQGEALATVTASLP 24077

Query: 2144  QGLGSREDLLAEVSGPSPPLARAYSFWG-------------QSSTQAQ--QHSRSHSKIS 2188
              G  S E +L     P+PPL   +  WG             + +TQA   QH+      S
Sbjct: 24076 SGQHSSEFILRLFPPPAPPLPPLHCHWGVGDMIFPSSPKPSKVNTQAN*AQHTHGAHSAS 23897

Query: 2189  KHMTPPAPC 2197
             + +T   PC
Sbjct: 23896 RQLT-QGPC 23873



 Score = 29.3 bits (64), Expect = 0.087
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = -1

Query: 2300  SRPKKKLSPPSITIDPPESQGPRTPPSP 2327
             S P+ KLSPP     PP ++GP+  P+P
Sbjct: 41503 SHPQPKLSPP-----PPGTRGPKPTPAP 41435



 Score = 28.5 bits (62), Expect = 0.15
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 7/95 (7%)
 Frame = -1

Query: 2280  QPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITID----PPESQGPRT---PPSPGICLR 2332
             +PH  +  S+LG  P   P S P     PP + ++    PP   GP     PPSP +  +
Sbjct: 39190 EPHSLSTLSHLG--PKLCPASLPLFLKPPPHLPVNLARPPPHP*GPLASPPPPSPPLHPQ 39017

Query: 2333  RRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSG 2367
              R+P S    PL    P +     + K+  LS +G
Sbjct: 39016 PRSPLS---PPLPPAQPPACPPC*AGKQHQLSNTG 38921



 Score = 28.1 bits (61), Expect = 0.19
 Identities = 31/114 (27%), Positives = 39/114 (34%), Gaps = 14/114 (12%)
 Frame = -2

Query: 2105  PHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEV-------- 2156
             PH+ PT   I    P    PL    +RR A        V  L   +  +A V        
Sbjct: 35481 PHAPPTGDFISWAAPGSADPLLL--VRRDAGPSASPRPVLVLLGSDMGVAAVWMMRGGSR 35308

Query: 2157  ----SGPSP--PLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNW 2204
                 SG SP    AR      +  T   Q  +SH +I  H    + CP   P W
Sbjct: 35307 LFRSSGCSPRDTTARGERERSRVHTGLAQGQKSHPRIGTHRPSTSSCPHHHPGW 35146



 Score = 27.7 bits (60), Expect = 0.25
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 343   AWIAIFQVITLEGWVDIMYFVMDA 366
             A +++F + + +GWVDIMY  +DA
Sbjct: 45441 ALMSLFVLASKDGWVDIMYDGLDA 45512



 Score = 27.3 bits (59), Expect = 0.33
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +3

Query: 1486  DGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLLI 1523
             +GWVDIMY  +DA          H+ +  +YFI  +++
Sbjct: 11574 EGWVDIMYFVMDA----------HSFYNFIYFILLIIV 11657



 Score = 26.9 bits (58), Expect = 0.43
 Identities = 28/83 (33%), Positives = 33/83 (39%), Gaps = 12/83 (14%)
 Frame = -3

Query: 2289  NLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAP--SSDSKDPL-- 2344
             N G Q L   G+R     S P + IDP + Q   T    G C     P  SS  ++P   
Sbjct: 31895 NRGWQELPSEGARGPGPHSAPPL-IDPEQQQSEST----GSCGSTVVPLNSSGLREPPN* 31731

Query: 2345  --------ASGPPDSMAASPSPK 2359
                     AS PP    A PSPK
Sbjct: 31730 CPIPGSIPASLPPSLQEAQPSPK 31662



 Score = 26.2 bits (56), Expect = 0.74
 Identities = 8/28 (28%), Positives = 20/28 (71%)
 Frame = +1

Query: 1515  LYFISFLLIVAFFVLNMFVGVVVENFHK 1542
             +YF+SF+L   F ++N+ + V++++  +
Sbjct: 57253 IYFVSFVLTAQFVLVNVVIAVLMKHLEE 57336



 Score = 25.8 bits (55), Expect = 0.96
 Identities = 8/25 (32%), Positives = 19/25 (76%)
 Frame = +3

Query: 1829  IYFVSFVLTAQFVLVNVVIAVLMKH 1853
             +YF+SF+L   F ++N+ + V++++
Sbjct: 46398 LYFISFLLIVAFFVLNMFVGVVVEN 46472



 Score = 25.8 bits (55), Expect = 0.96
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = -1

Query: 2084  SQPADTSYILQLPKDAPHLLQPHSAPTWGTIPKLPPPGRSPL 2125
             SQP  ++   +   +  H   PH+AP WG      P GR PL
Sbjct: 53830 SQPPASNARTETFHNHHHPRPPHAAPWWG-----QPSGRVPL 53720



 Score = 25.0 bits (53), Expect = 1.6
 Identities = 25/94 (26%), Positives = 30/94 (31%), Gaps = 9/94 (9%)
 Frame = -1

Query: 586 SGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLL--------- 636
           SG   P     P P TL+         SS PPT      PP   +   +           
Sbjct: 403 SGAPSPPWQPPPHPPTLRAHFDSPGGGSSSPPTPGGAARPPSDPAPGRRAPKDMGYRPCG 224

Query: 637 ETQSTGACQSSCKISSPCLKADSGACGPDSCPYC 670
           +T S G C  S +   P   A   A  P   P C
Sbjct: 223 DTSSAGGCPGSSRRKPPG-PAPGTAAPPPRSPRC 125



 Score = 25.0 bits (53), Expect = 1.6
 Identities = 18/58 (31%), Positives = 23/58 (39%)
 Frame = -2

Query: 571   PPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLTSLNIPPGP 628
             P P  PS   G         P V+ +PP        LV    ++GPPT  +L   P P
Sbjct: 17610 PDPNRPSFHPGAGTNPPLCTP-VYMAPPASNQSHPDLVGQMDATGPPT-PALRTTPSP 17443



 Score = 25.0 bits (53), Expect = 1.6
 Identities = 14/38 (36%), Positives = 16/38 (42%)
 Frame = +2

Query: 2298  PGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRA 2335
             PG+      S  S+        GPR  PSP  CL  RA
Sbjct: 39215 PGNLEAWSCSYSSVCSAEQRGTGPRVDPSPTPCLLPRA 39328



 Score = 24.6 bits (52), Expect = 2.1
 Identities = 13/46 (28%), Positives = 22/46 (47%)
 Frame = +2

Query: 1391  VISRAQGLKLVVETLMSSLKPIGNXXXXXXXXXXXXXXLGVQLFKG 1436
             V S   G++++V  L+ +L  +GN              +GVQL+ G
Sbjct: 10400 VASAPTGMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG 10537



 Score = 24.3 bits (51), Expect = 2.8
 Identities = 26/102 (25%), Positives = 39/102 (38%), Gaps = 4/102 (3%)
 Frame = +1

Query: 1936  SLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAEMEALSLTSEIVSEPS 1995
             SL +   L W   +  +L  PGGQ             +P  P    +  S+ ++     S
Sbjct: 64798 SLELDTELSW---ISGDLLPPGGQ------------EEPPSPRDLKKCYSVEAQ-----S 64917

Query: 1996  CSLALTDDSLPDDMHTLLLSALESNMQPH----PTELPGPDL 2033
             C    T        H++ +S L+S  QPH    P+ L G  L
Sbjct: 64918 CQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPL 65043



 Score = 24.3 bits (51), Expect = 2.8
 Identities = 14/48 (29%), Positives = 17/48 (35%)
 Frame = +1

Query: 2296  GGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKDP 2343
             G P  +    L PP I   P     P +PP P      + P     DP
Sbjct: 14365 GDPAQQQLLSLPPPPIRPPPGAPPPPPSPPLPPGQWDAQGPPGQPGDP 14508



 Score = 23.9 bits (50), Expect = 3.7
 Identities = 42/138 (30%), Positives = 54/138 (39%), Gaps = 5/138 (3%)
 Frame = -2

Query: 534   LPPPSTPALSGAPPGGAESV--HSFYHADCHLEPVRCQAP--PPRSPSEASGRTVGSGKV 589
             L PP    LS  PPG A  +   +      HL P RC+     PR PS      V     
Sbjct: 23403 LVPPFLGLLS--PPGAASILLDSAAPSPTPHLAP-RCRLTWGAPR-PSSKELCVVHPTVS 23236

Query: 590   YPTVHTSPPPETLKEKALV-EVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSC 648
              P +  S P   L   +L+   AA   PPT    +  PGP+   +  +   S        
Sbjct: 23235 LPLLEGSQPFLHLHFDSLMCSPAAPLSPPTPAPGS--PGPWPISYACIHYFSN------- 23083

Query: 649   KISSPCLKADSGACGPDS 666
              +  PCLKA+S    PDS
Sbjct: 23082 -LLPPCLKAESFCGTPDS 23032



 Score = 23.9 bits (50), Expect = 3.7
 Identities = 18/52 (34%), Positives = 20/52 (38%)
 Frame = -1

Query: 1880  PQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASHFSLEHPTDRQL 1931
             P P  PL       GV     P SPKP  ++    A  A H    H   RQL
Sbjct: 24037 PPPAPPLPPLHCHWGVGDMIFPSSPKPSKVN--TQAN*AQHTHGAHSASRQL 23888



 Score = 23.9 bits (50), Expect = 3.7
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = -2

Query: 1050  LPKSTSTGLGEALGPASRRTSSSGSAE 1076
             L   +  GLG   GPA R+T+S    E
Sbjct: 27342 LSDCSKAGLGAESGPAGRQTASYAEGE 27262



 Score = 23.9 bits (50), Expect = 3.7
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = -2

Query: 616   PPTLTSLNIPPGPYSSMHKLLETQS 640
             PP L SL  PP P++++  +  +++
Sbjct: 53634 PPPLGSLQNPPAPHNTLDSVFRSKA 53560



 Score = 23.9 bits (50), Expect = 3.7
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +3

Query: 919   ILTQEDWNKVLYNGMASTSSWAALYFIALM 948
             ++T E W  ++Y  M + S +  +YFI L+
Sbjct: 11562 VITLEGWVDIMYFVMDAHSFYNFIYFILLI 11651



 Score = 23.5 bits (49), Expect = 4.8
 Identities = 29/106 (27%), Positives = 38/106 (35%), Gaps = 16/106 (15%)
 Frame = -3

Query: 2269  SIAVSCLDSGSQPHLGTDPSNLGGQ--------PLGGP--GSRPKKKLS------PPSIT 2312
             S+  +  +SGS P     P  L  +        P G P  GS  + + S      PP   
Sbjct: 39329 SLEAAGRESGSDPRADPFPFALQNKHWSMSRTRPPGSPAPGSSAESRASLLVYPLPPGAQ 39150

Query: 2313  IDPPESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSP 2358
               P  S       S   C   +APS   + P  S    S  ASP+P
Sbjct: 39149 ALPCLSSFIPKATSSSPCQPCQAPSPSLRTPCLSTSSLSSPASPTP 39012



 Score = 23.5 bits (49), Expect = 4.8
 Identities = 11/42 (26%), Positives = 19/42 (45%)
 Frame = -3

Query: 2317  ESQGPRTPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSP 2358
             + + P   P+P +  + R P S  +    S  PDS+ +   P
Sbjct: 39542 QREAPPAAPAPPVPSQLRPPCSHPRQGATSQIPDSITSGNFP 39417



 Score = 23.5 bits (49), Expect = 4.8
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = -1

Query: 2193  PPAPCPGPEPNWGKGPPETR 2212
             PPAP P P  + G+G    R
Sbjct: 46663 PPAPAPSPLQSQGQGQARPR 46604



 Score = 23.5 bits (49), Expect = 4.8
 Identities = 26/91 (28%), Positives = 30/91 (32%), Gaps = 14/91 (15%)
 Frame = -1

Query: 513   RAPRASPEIQDRDANGSRRLMLPPPSTPALSGAP--------------PGGAESVHSFYH 558
             R  R SP +Q     G R    P  S PAL GAP              P G    H    
Sbjct: 48676 RGLRPSPPVQF--GAGLRDAAEPSASAPALLGAPGTLTLSPQEDRINEPRGGSEEH---- 48515

Query: 559   ADCHLEPVRCQAPPPRSPSEASGRTVGSGKV 589
                   P R    P RS   ++G   GS  +
Sbjct: 48514 -----VPTRMSPHPRRST*RSAG*AAGSNYI 48437



 Score = 23.5 bits (49), Expect = 4.8
 Identities = 8/28 (28%), Positives = 17/28 (60%)
 Frame = +2

Query: 1453  SDCAEASYRWVRHKYNFDNLGQALMSLF 1480
             ++C+   +   +   NFDN+G A +++F
Sbjct: 11309 TNCSAGEHNPFKGAINFDNIGYAWIAIF 11392



 Score = 23.1 bits (48), Expect = 6.2
 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%)
 Frame = +3

Query: 2295  LGGPGSRPKKKLSPPSITIDPPESQGP----RTPPSPGIC 2330
             L GPG +P    S PS+    P+   P     +P   G+C
Sbjct: 58299 LAGPGGQPSAFPSAPSLGGSDPQVTVPLCCALSPDRAGLC 58418



 Score = 23.1 bits (48), Expect = 6.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 533   MLPPPSTPALSGAPPGG 549
             + PP  TP+LS  P GG
Sbjct: 27624 LCPPGQTPSLSRHPSGG 27674



 Score = 23.1 bits (48), Expect = 6.2
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = +2

Query: 2180  HSRSHSKISKHMTPPAPCPGPE 2201
             H++  ++ S+  +   PCPGPE
Sbjct: 22271 HAQGGTRCSEGQSGFPPCPGPE 22336



 Score = 23.1 bits (48), Expect = 6.2
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +1

Query: 2188  SKHMTPPAPCPGPEPNWGKG 2207
             S H+ PP P P P P  G+G
Sbjct: 13093 SHHVPPPPPLPFP-PGLGRG 13149



 Score = 22.7 bits (47), Expect = 8.1
 Identities = 25/98 (25%), Positives = 35/98 (35%), Gaps = 7/98 (7%)
 Frame = -3

Query: 2287 PSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDSKDPLAS 2346
            P  LG    G PG        PPS     P +  P  PP+P    +       ++   +S
Sbjct: 764  PQTLGRGKEGNPGD-----CGPPS---SVPAASSPPPPPTPHQTRKPNPAR*PARAEYSS 609

Query: 2347 GPPDS-----MAASPSPKKDVLSL--SGLSSDPADLDP 2377
              P++     M   P P  + + L  SG       LDP
Sbjct: 608  QAPEASHIWRMTTLP*PHLEGVQLRASGAQLSSPGLDP 495



 Score = 22.7 bits (47), Expect = 8.1
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 2283  LGTDPSNLGGQPLGGPGSRPKKKLSPPSIT 2312
             LG    +LGG  +GG G  P   L   S++
Sbjct: 59848 LGPPAPSLGGGSVGGAGEAPGVSLECVSVS 59937



 Score = 22.7 bits (47), Expect = 8.1
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = -2

Query: 2252  QSCQRRPTSWLDEQRRHSIAVSCLDSGSQP 2281
             Q C  RP  W   + + S   S   +GSQP
Sbjct: 34281 QECWLRPEFWCWGREQQSTGSSWGQTGSQP 34192



 Score = 22.7 bits (47), Expect = 8.1
 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 1/28 (3%)
 Frame = -1

Query: 2302  PKKKLSPPSITIDPPESQGPR-TPPSPG 2328
             P  +  PPS+    P    P+ +PP PG
Sbjct: 41548 PPPRHRPPSLRCSQPSHPQPKLSPPPPG 41465



 Score = 22.7 bits (47), Expect = 8.1
 Identities = 24/93 (25%), Positives = 34/93 (36%), Gaps = 14/93 (15%)
 Frame = -3

Query: 2142  DVQGLGSREDLL--------AEVSGP---SPPLARAYSFWGQSSTQAQQHSRSHSKISKH 2190
             + QG G +  LL        A+ + P    PP     +  G    +     R  ++    
Sbjct: 60095 EAQGGGKKASLLSPHPFPKQADSASPHPLQPPALIREAAAGTEEPEQTLTKRGDTETHSK 59916

Query: 2191  MTP---PAPCPGPEPNWGKGPPETRSSLELDTE 2220
              TP   PAP   P P  G G P    S + DT+
Sbjct: 59915 DTPGASPAPPTLPPPREGAGGPRACDSQKDDTK 59817


Lambda     K      H
   0.320    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 279,471
Number of Sequences: 0
Number of extensions: 7861
Number of successful extensions: 146
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 144
length of query: 2377
length of database: 21,935
effective HSP length: 73
effective length of query: 2304
effective length of database: 21,862
effective search space: 50370048
effective search space used: 50370048
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 46 (22.3 bits)

END