Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_009237.1
Subject Sequence ID: ENSG00000012048
Subject Sequence type: 3

Query= gi|6552323|ref|NP_009237.1| breast cancer 1, early onset
isoform BRCA1-exon4; breast-ovarian cancer, included [Homo sapiens]
         (59 letters)

>ENSG00000012048
          Length = 81091

 Score = 53.5 bits (127), Expect = 6e-11
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -3

Query: 1     MDLSALRVEEVQNVINAMQKILECPI 26
             MDLSALRVEEVQNVINAMQKILECPI
Sbjct: 79796 MDLSALRVEEVQNVINAMQKILECPI 79719



 Score = 45.1 bits (105), Expect = 2e-08
 Identities = 20/26 (76%), Positives = 21/26 (80%)
 Frame = -2

Query: 25    PICLELIKEPVSTKCDHIFCKVLLCC 50
             P  LELIKEPVSTKCDHIFCK +  C
Sbjct: 71487 PASLELIKEPVSTKCDHIFCK*V*MC 71410



 Score = 35.8 bits (81), Expect = 1e-05
 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 10/35 (28%)
 Frame = -2

Query: 35    VSTKCDHIFC----------KVLLCCPSWSTVVRS 59
             VS KC+  F           +VLLCCPSWSTVVRS
Sbjct: 66342 VSNKCNLNFSTATFFFFF*DRVLLCCPSWSTVVRS 66238



 Score = 30.4 bits (67), Expect = 5e-04
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = -3

Query: 45    KVLLCCPSWSTVVRS 59
             +VLLCCP WS V RS
Sbjct: 41054 RVLLCCPGWSAVARS 41010



 Score = 29.6 bits (65), Expect = 9e-04
 Identities = 11/14 (78%), Positives = 11/14 (78%)
 Frame = -1

Query: 46    VLLCCPSWSTVVRS 59
             VLLCCP WS V RS
Sbjct: 78748 VLLCCPGWSAVARS 78707



 Score = 28.9 bits (63), Expect = 0.001
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -3

Query: 41    HIFCKVLLCCPSWSTV 56
             H+  +VLLCCPSW  V
Sbjct: 36512 HLIERVLLCCPSWRAV 36465



 Score = 28.1 bits (61), Expect = 0.002
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 2/15 (13%)
 Frame = -2

Query: 42    IFC--KVLLCCPSWS 54
             IFC  KV LCCPSWS
Sbjct: 36348 IFCRDKVSLCCPSWS 36304



 Score = 28.1 bits (61), Expect = 0.002
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -2

Query: 45    KVLLCCPSWSTVV 57
             +VLLCCP WST V
Sbjct: 52071 RVLLCCPGWSTEV 52033



 Score = 28.1 bits (61), Expect = 0.002
 Identities = 10/14 (71%), Positives = 11/14 (78%)
 Frame = -2

Query: 46    VLLCCPSWSTVVRS 59
             VL CCP WS VV+S
Sbjct: 66792 VLFCCPGWSAVVQS 66751



 Score = 26.6 bits (57), Expect = 0.007
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 7/40 (17%)
 Frame = -3

Query: 27    CLELIKEPVSTKCDHIFCKVL-------LCCPSWSTVVRS 59
             C +  +EP     D +FC VL       LCC  WS V RS
Sbjct: 77138 CWDYRREPPLP--DFLFCFVLFF*DTVSLCCLGWSAVARS 77025



 Score = 26.2 bits (56), Expect = 0.009
 Identities = 10/14 (71%), Positives = 11/14 (78%), Gaps = 2/14 (14%)
 Frame = +1

Query: 43    FCK--VLLCCPSWS 54
             FC+  VLLCCP WS
Sbjct: 53908 FCRDEVLLCCPGWS 53949



 Score = 26.2 bits (56), Expect = 0.009
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -2

Query: 46    VLLCCPSWSTVVRS 59
             V LCCP WS V++S
Sbjct: 51273 VSLCCPGWSAVMQS 51232



 Score = 25.8 bits (55), Expect = 0.012
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +1

Query: 46    VLLCCPSWSTVVRS 59
             V LCCP WS V +S
Sbjct: 39757 VSLCCPGWSAVAQS 39798



 Score = 25.8 bits (55), Expect = 0.012
 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 5/43 (11%)
 Frame = +2

Query: 22   LECPICLELIKEP-----VSTKCDHIFCKVLLCCPSWSTVVRS 59
            L  P C +  +EP     +S        KV LC P WS VV+S
Sbjct: 4154 LSLPKCWDYRREPPHLAFLSLSFFFFLDKVSLCHPVWSAVVQS 4282



 Score = 25.4 bits (54), Expect = 0.016
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 45    KVLLCCPSWSTV 56
             +VL CCP WS V
Sbjct: 56920 RVLFCCPGWSVV 56955



 Score = 25.4 bits (54), Expect = 0.016
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 45    KVLLCCPSWSTV 56
             +V LCCP WS V
Sbjct: 64401 RVFLCCPGWSAV 64366



 Score = 25.4 bits (54), Expect = 0.016
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 49    CCPSWSTVVRS 59
             CCP WS +VRS
Sbjct: 15806 CCPGWSAMVRS 15838



 Score = 24.6 bits (52), Expect = 0.028
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -3

Query: 46    VLLCCPSWSTVVRS 59
             V LC P WSTV RS
Sbjct: 73430 VQLCRPGWSTVARS 73389



 Score = 24.3 bits (51), Expect = 0.036
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 45    KVLLCCPSWS 54
             K LLCCP+WS
Sbjct: 58544 KDLLCCPNWS 58573



 Score = 24.3 bits (51), Expect = 0.036
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = +1

Query: 45    KVLLCCPSWSTVVRS 59
             +VLLC P WS V +S
Sbjct: 56065 RVLLCHPGWSAVAQS 56109



 Score = 24.3 bits (51), Expect = 0.036
 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 8/35 (22%)
 Frame = -3

Query: 31    IKEPVSTKCDHIFCKVLL--------CCPSWSTVV 57
             + EP       +FC VL         CCP WS +V
Sbjct: 34934 VSEPSLCLSFFLFCFVLFLFEMKFHFCCPGWSAMV 34830



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 2/23 (8%)
 Frame = +2

Query: 39    CDHIFC--KVLLCCPSWSTVVRS 59
             C  +FC   V LC P WS + RS
Sbjct: 80456 CFVLFCFETVSLCRPGWSAMARS 80524



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +3

Query: 43    FCKVLLCCPSWSTV 56
             F +VLLC P WS V
Sbjct: 53742 FLEVLLCHPGWSAV 53783



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +2

Query: 46    VLLCCPSWSTVVRS 59
             VLLC P WS + RS
Sbjct: 31289 VLLCRPGWSAMARS 31330



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 49    CCPSWSTVVRS 59
             CCP WS +V+S
Sbjct: 25669 CCPGWSAMVQS 25701



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = -2

Query: 43    FCKVLLCCPSWSTVVR 58
             F  + LCCP W+ +V+
Sbjct: 64038 FGTISLCCPGWNAMVQ 63991



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -1

Query: 49    CCPSWSTVVRS 59
             CCP WS + RS
Sbjct: 64675 CCPGWSAMARS 64643



 Score = 23.9 bits (50), Expect = 0.047
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 46    VLLCCPSWSTV 56
             V LCCP WS V
Sbjct: 67211 VSLCCPDWSAV 67179



 Score = 23.9 bits (50), Expect(2) = 0.024
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +3

Query: 45   KVLLCCPSWSTVV 57
            +VLLC P WS VV
Sbjct: 3495 RVLLCHPGWSAVV 3533



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 6/50 (12%)
 Frame = +2

Query: 11    VQNVINAMQKILEC---PICLELIKEPVSTKCDHI-FCK--VLLCCPSWS 54
             +  V+N+  +++ C   P C +   EP+     ++ FC   V L CP WS
Sbjct: 64766 LSTVLNSRPQVIACFSLPKCWDYRCEPLRWATFYLYFCTDVVSLYCPVWS 64915



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +1

Query: 46    VLLCCPSWSTVVRS 59
             V LC P WS V RS
Sbjct: 62791 VSLCLPGWSAVARS 62832



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 46    VLLCCPSWSTVVRS 59
             V LCCP W+ + +S
Sbjct: 27699 VSLCCPGWNAMAQS 27658



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +1

Query: 45    KVLLCCPSWSTV 56
             +VLLC P W+TV
Sbjct: 33808 RVLLCYPGWNTV 33843



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 2/14 (14%)
 Frame = -3

Query: 42    IFCK--VLLCCPSW 53
             IFC+  VL CCP W
Sbjct: 61670 IFCRDEVLPCCPGW 61629



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 10/18 (55%), Positives = 12/18 (66%), Gaps = 2/18 (11%)
 Frame = +2

Query: 43   FCK--VLLCCPSWSTVVR 58
            FC+  VLL CP WS+  R
Sbjct: 3773 FCRHEVLLYCPGWSSAPR 3826



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -1

Query: 49    CCPSWSTVVRS 59
             CCP WS V +S
Sbjct: 77365 CCPGWSAVAQS 77333



 Score = 23.5 bits (49), Expect = 0.061
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +1

Query: 45   KVLLCCPSWSTVVR 58
            +V LCCP WS   R
Sbjct: 2989 EVSLCCPGWSRTSR 3030



 Score = 23.1 bits (48), Expect = 0.080
 Identities = 11/19 (57%), Positives = 12/19 (63%), Gaps = 1/19 (5%)
 Frame = -2

Query: 39    CDHIF-CKVLLCCPSWSTV 56
             C  IF  +VLLC P WS V
Sbjct: 11655 C*FIFRARVLLCHPGWSAV 11599



 Score = 23.1 bits (48), Expect = 0.080
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -2

Query: 49    CCPSWSTVV 57
             CCP WS VV
Sbjct: 43344 CCPGWSAVV 43318



 Score = 23.1 bits (48), Expect = 0.080
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 46    VLLCCPSWSTVV 57
             VLLC P WS VV
Sbjct: 29481 VLLCHPDWSAVV 29516



 Score = 23.1 bits (48), Expect = 0.080
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 3/36 (8%)
 Frame = -3

Query: 22    LECPICLELIKEPVSTKCDHIFC---KVLLCCPSWS 54
             L  P C +   +P+       FC   +VLLC P WS
Sbjct: 78515 LGLPKC*DYRHKPLRPAILVFFCCRDRVLLCWPCWS 78408



 Score = 22.7 bits (47), Expect = 0.10
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 46    VLLCCPSWS 54
             V LCCPSW+
Sbjct: 58678 VSLCCPSWA 58704



 Score = 22.7 bits (47), Expect = 0.10
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 46    VLLCCPSWSTV 56
             VL CCP WS +
Sbjct: 31617 VLPCCPGWSQI 31585



 Score = 22.7 bits (47), Expect(2) = 0.094
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +2

Query: 46    VLLCCPSWSTVVRS 59
             V LC P WS VV+S
Sbjct: 46100 VSLCHPGWSAVVQS 46141



 Score = 22.7 bits (47), Expect = 0.10
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -1

Query: 46    VLLCCPSWSTVVRS 59
             V LC P WS VV+S
Sbjct: 67513 VSLCRPGWSAVVQS 67472



 Score = 22.7 bits (47), Expect = 0.10
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +2

Query: 46   VLLCCPSWSTVVRS 59
            V LC P WS V RS
Sbjct: 3929 VSLCRPGWSAVARS 3970



 Score = 22.7 bits (47), Expect = 0.10
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 45   KVLLCCPSWS 54
            +VL CCP WS
Sbjct: 3663 RVLPCCPGWS 3692



 Score = 22.7 bits (47), Expect = 0.10
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 46   VLLCCPSWSTVV 57
            V LC P WSTVV
Sbjct: 2826 VSLCRPGWSTVV 2861



 Score = 22.3 bits (46), Expect = 0.14
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 49    CCPSWSTVVRS 59
             CCP WS + +S
Sbjct: 28071 CCPGWSAMAQS 28039



 Score = 22.3 bits (46), Expect = 0.14
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -3

Query: 46    VLLCCPSWSTVVRS 59
             +LLC P W+ VV+S
Sbjct: 45698 LLLCYPGWNGVVQS 45657



 Score = 22.3 bits (46), Expect = 0.14
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +1

Query: 46    VLLCCPSWSTVVRS 59
             VLLC P WS V  S
Sbjct: 20557 VLLCQPGWSAVAGS 20598



 Score = 22.3 bits (46), Expect = 0.14
 Identities = 8/13 (61%), Positives = 9/13 (69%), Gaps = 2/13 (15%)
 Frame = +2

Query: 43    FC--KVLLCCPSW 53
             FC  +V LCCP W
Sbjct: 17972 FCGDRVSLCCPGW 18010



 Score = 22.3 bits (46), Expect = 0.14
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +3

Query: 46    VLLCCPSWSTVVRS 59
             VLLC   WS V+RS
Sbjct: 16218 VLLCRSGWSAVMRS 16259



 Score = 21.9 bits (45), Expect = 0.18
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 48    LCCPSWSTVVRS 59
             LCC  WS VV S
Sbjct: 74496 LCCSGWSAVVWS 74531



 Score = 21.9 bits (45), Expect = 0.18
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 50    CPSWSTVVRS 59
             CP WS +VRS
Sbjct: 55009 CPGWSAMVRS 55038



 Score = 21.9 bits (45), Expect = 0.18
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -2

Query: 45    KVLLCCPSWS 54
             +VLLCC  WS
Sbjct: 28860 RVLLCCRGWS 28831



 Score = 21.9 bits (45), Expect = 0.18
 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 2/14 (14%)
 Frame = +3

Query: 43    FCK--VLLCCPSWS 54
             FC+  VLLC P WS
Sbjct: 39033 FCRNRVLLCWPGWS 39074



 Score = 21.9 bits (45), Expect = 0.18
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -1

Query: 46    VLLCCPSWS 54
             + LCCP WS
Sbjct: 45532 ISLCCPGWS 45506



 Score = 21.9 bits (45), Expect = 0.18
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = -1

Query: 45    KVLLCCPSWSTVVR 58
             +V LC P WS V R
Sbjct: 59161 RVSLCRPGWSAVTR 59120



 Score = 21.6 bits (44), Expect = 0.23
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +1

Query: 49    CCPSWSTVVRS 59
             CC  WS +VRS
Sbjct: 54553 CCLGWSAMVRS 54585



 Score = 21.6 bits (44), Expect = 0.23
 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%)
 Frame = +2

Query: 34    PVSTKCDHIFCK--VLLCCPSWS 54
             P++  C  IFC+  VL C P WS
Sbjct: 33941 PLANFC--IFCRDGVLPCWPGWS 34003



 Score = 21.2 bits (43), Expect = 0.30
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +1

Query: 46    VLLCCPSWSTVV 57
             V L CP WS VV
Sbjct: 54085 VSLYCPGWSAVV 54120



 Score = 21.2 bits (43), Expect = 0.30
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +3

Query: 32    KEPVSTKCDHIFCKVLLCCPSWS 54
             K PVSTK   +   V  C PS+S
Sbjct: 21189 KNPVSTKNTKLGMVVHSCNPSYS 21257



 Score = 21.2 bits (43), Expect = 0.30
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -1

Query: 46    VLLCCPSWSTVV 57
             V L CP WS VV
Sbjct: 69766 VSLYCPGWSAVV 69731



 Score = 21.2 bits (43), Expect = 0.30
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -2

Query: 45    KVLLCCPSWSTV 56
             KV LC P WS V
Sbjct: 71196 KVSLCRPGWSAV 71161



 Score = 20.8 bits (42), Expect = 0.40
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = -1

Query: 45   KVLLCCPSWSTVVRS 59
            +V LC P WS V  S
Sbjct: 9361 RVSLCHPGWSAVAPS 9317



 Score = 20.8 bits (42), Expect = 0.40
 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 8/30 (26%)
 Frame = -2

Query: 35    VSTKCDH---IFC-----KVLLCCPSWSTV 56
             ++  C H   +FC     KV  C P WS +
Sbjct: 11367 ITGTCHHTEIVFCIFNRNKVSTCWPGWSQI 11278



 Score = 20.8 bits (42), Expect = 0.40
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +1

Query: 46    VLLCCPSWSTVVRS 59
             +LLC P  STV RS
Sbjct: 67816 ILLCRPG*STVARS 67857



 Score = 20.8 bits (42), Expect = 0.40
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 46    VLLCCPSWSTVVR 58
             VLLC P W+ V +
Sbjct: 45014 VLLCHPGWNAVAQ 44976



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = -3

Query: 46    VLLCCPSWSTVVRS 59
             V LC P WS V  S
Sbjct: 13202 VSLCYPGWSAVAPS 13161



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 46    VLLCCPSWS 54
             +LLCC  WS
Sbjct: 59216 ILLCCLGWS 59242



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 2/15 (13%)
 Frame = -1

Query: 42    IFCK--VLLCCPSWS 54
             +FC+  V LCC  WS
Sbjct: 55870 LFCRDWVSLCCLCWS 55826



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = +2

Query: 45    KVLLCCPSWSTVVRS 59
             ++ L  P WS +VRS
Sbjct: 22541 RISLLSPGWSAMVRS 22585



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +2

Query: 46    VLLCCPSW 53
             VL CCP W
Sbjct: 12071 VLPCCPGW 12094



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 2/11 (18%)
 Frame = +1

Query: 43    FCK--VLLCCP 51
             FC+  VLLCCP
Sbjct: 10318 FCRDRVLLCCP 10350



 Score = 20.4 bits (41), Expect = 0.52
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +1

Query: 46   VLLCCPSWSTVVRS 59
            V LC   WS VVRS
Sbjct: 7363 VSLCHLGWSVVVRS 7404



 Score = 20.0 bits (40), Expect = 0.68
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = +2

Query: 43    FCKVLLCCPSWSTVVRS 59
             FC    C P W  +VRS
Sbjct: 72245 FC---FCSPDWHAMVRS 72286



 Score = 20.0 bits (40), Expect = 0.68
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -2

Query: 46    VLLCCPSWSTV 56
             V L CP WS V
Sbjct: 13527 VSLSCPGWSAV 13495



 Score = 20.0 bits (40), Expect = 0.68
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 45    KVLLCCPSWSTV 56
             +V LC P WS V
Sbjct: 13714 RVSLCHPGWSAV 13679



 Score = 20.0 bits (40), Expect = 0.68
 Identities = 8/15 (53%), Positives = 8/15 (53%)
 Frame = +2

Query: 45    KVLLCCPSWSTVVRS 59
             KV  C P WS V  S
Sbjct: 10163 KVSQCWPGWSAVAPS 10207



 Score = 20.0 bits (40), Expect = 0.68
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = -2

Query: 46    VLLCCPSWSTVVRS 59
             V LC P WS V  S
Sbjct: 76761 VWLCRPGWSAVAPS 76720



 Score = 20.0 bits (40), Expect = 0.68
 Identities = 5/11 (45%), Positives = 8/11 (72%)
 Frame = +1

Query: 49   CCPSWSTVVRS 59
            CC +W+ + RS
Sbjct: 1966 CCSAWNAMARS 1998



 Score = 19.6 bits (39), Expect(2) = 0.18
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 51    PSWSTVVRS 59
             P WS VVRS
Sbjct: 39605 PGWSAVVRS 39631



 Score = 19.6 bits (39), Expect = 0.89
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +2

Query: 46    VLLCCPSWSTVVRS 59
             VLL  P+WS V +S
Sbjct: 15632 VLLFRPAWSAVAQS 15673



 Score = 19.2 bits (38), Expect = 1.2
 Identities = 7/15 (46%), Positives = 8/15 (53%)
 Frame = +3

Query: 45    KVLLCCPSWSTVVRS 59
             +V  C P WS V  S
Sbjct: 74100 RVSFCRPGWSAVAPS 74144



 Score = 19.2 bits (38), Expect = 1.2
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -1

Query: 46    VLLCCPSWSTVVRS 59
             V L CP  S VVRS
Sbjct: 12364 VSLHCPGQSAVVRS 12323



 Score = 19.2 bits (38), Expect = 1.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -2

Query: 45    KVLLCCPSWSTV 56
             +VLLC   WS V
Sbjct: 30615 RVLLCHSGWSAV 30580



 Score = 19.2 bits (38), Expect(2) = 0.18
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 43    FCKVLLCCP 51
             F  VLLCCP
Sbjct: 39580 FETVLLCCP 39606



 Score = 19.2 bits (38), Expect = 1.2
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 45    KVLLCCPSW 53
             +VLLC P W
Sbjct: 23560 RVLLCHPGW 23586



 Score = 19.2 bits (38), Expect = 1.2
 Identities = 12/35 (34%), Positives = 14/35 (40%), Gaps = 1/35 (2%)
 Frame = -1

Query: 25    PICLELIKEPVSTKCDHIF-CKVLLCCPSWSTVVR 58
             P C +   EP        F  +V LC   WS V R
Sbjct: 73201 PKCWDYKHEPPCLALFSFF*DRVFLCHLGWSAVAR 73097



 Score = 18.9 bits (37), Expect = 1.5
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +1

Query: 48    LCCPSWST 55
             LC P+W+T
Sbjct: 52036 LCTPAWAT 52059



 Score = 18.9 bits (37), Expect = 1.5
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 49    CCPSWSTVVR 58
             C P+W+T V+
Sbjct: 34836 CTPAWATKVK 34865



 Score = 18.9 bits (37), Expect = 1.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -1

Query: 23    ECPICLELIKEPVSTK 38
             EC   L  + +PVSTK
Sbjct: 56656 ECETSLANMAKPVSTK 56609



 Score = 18.9 bits (37), Expect = 1.5
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -2

Query: 49    CCPSWSTVVRS 59
             C P+W+T V++
Sbjct: 68559 CTPAWATRVKT 68527



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -3

Query: 49    CCPSWSTVVRS 59
             C P WS V +S
Sbjct: 11468 CWPVWSAVAQS 11436



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -1

Query: 49    CCPSWSTVVR 58
             C P+W+T V+
Sbjct: 15826 CTPAWATRVK 15797



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 13/45 (28%), Positives = 18/45 (40%), Gaps = 1/45 (2%)
 Frame = +2

Query: 13    NVINAMQKILECPICLELIKEPVSTKCDHIFCK-VLLCCPSWSTV 56
             N++ +    L  P C +    P        FC  +LLC P  S V
Sbjct: 58277 NLLTS*STGLSLPRCWDCRC*PPHPASSFFFCN*ILLCRPR*SAV 58411



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +1

Query: 45    KVLLCCPSWS 54
             +V LC P WS
Sbjct: 54397 RVPLCWPGWS 54426



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = +1

Query: 49    CCPSW 53
             CCP W
Sbjct: 45283 CCPGW 45297



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +1

Query: 49    CCPSWSTVVR 58
             C P+W+T V+
Sbjct: 43324 CTPAWATRVK 43353



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -2

Query: 49    CCPSWSTVVR 58
             C P+W+T V+
Sbjct: 45303 CSPAWATRVK 45274



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +1

Query: 49    CCPSWSTVVR 58
             C P+W+T V+
Sbjct: 28051 CTPAWATRVK 28080



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 9/18 (50%), Positives = 9/18 (50%), Gaps = 5/18 (27%)
 Frame = +1

Query: 42   IFC-----KVLLCCPSWS 54
            IFC      V LC P WS
Sbjct: 8743 IFCIFSRNGVSLCWPGWS 8796



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = -2

Query: 42    IFCKVLLCCPSW 53
             +F + +LC P W
Sbjct: 74976 LFLRWILCHPGW 74941



 Score = 18.5 bits (36), Expect(2) = 0.024
 Identities = 7/21 (33%), Positives = 12/21 (57%), Gaps = 1/21 (4%)
 Frame = +2

Query: 32   KEPVST-KCDHIFCKVLLCCP 51
            + P ST  C H+  + ++ CP
Sbjct: 3305 RTPYSTGTCRHLTMEAIVLCP 3367



 Score = 18.5 bits (36), Expect = 2.0
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 49  CCPSWSTVV 57
           C P WS VV
Sbjct: 539 CHPGWSAVV 565



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 7/26 (26%), Positives = 15/26 (57%)
 Frame = -3

Query: 10    EVQNVINAMQKILECPICLELIKEPV 35
             E+ +    M++  E   CL++ +EP+
Sbjct: 21638 EILSFEEEMRRFKEIRHCLQVSEEPL 21561



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = -3

Query: 45    KVLLCCPSWS 54
             ++ L CP WS
Sbjct: 24245 EISLYCPGWS 24216



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 8/23 (34%), Positives = 12/23 (52%)
 Frame = -1

Query: 34    PVSTKCDHIFCKVLLCCPSWSTV 56
             P++     +FCKVL    S  T+
Sbjct: 31150 PLNLLISILFCKVLSTWKSRGTI 31082



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 6/11 (54%), Positives = 6/11 (54%)
 Frame = +1

Query: 44    CKVLLCCPSWS 54
             C V  C P WS
Sbjct: 46261 CGVSPCWPGWS 46293



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = +2

Query: 26    ICLELIKEPVSTKCDHI 42
             +CL  ++E   T  DHI
Sbjct: 44462 MCLRQVREHKQTV*DHI 44512



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +1

Query: 46    VLLCCPSW 53
             VLLC P W
Sbjct: 33757 VLLC*PGW 33780



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +1

Query: 45    KVLLCCPSWS 54
             +V L CP WS
Sbjct: 28606 QVSLHCPGWS 28635



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -1

Query: 46    VLLCCPSWS 54
             V LC P WS
Sbjct: 53278 VSLCWPGWS 53252



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 45    KVLLCCPSWSTV 56
             +VLLC   WS V
Sbjct: 61813 RVLLCH*GWSAV 61778



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -1

Query: 42    IFCKVLLC 49
             +FC++L C
Sbjct: 63643 LFCRILFC 63620



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -1

Query: 46    VLLCCPSWS 54
             V LC P WS
Sbjct: 67045 VSLCWPGWS 67019



 Score = 18.1 bits (35), Expect = 2.6
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -1

Query: 46    VLLCCPSWS 54
             V LC P WS
Sbjct: 73264 VSLCWPGWS 73238



 Score = 17.7 bits (34), Expect = 3.4
 Identities = 7/22 (31%), Positives = 13/22 (59%)
 Frame = -3

Query: 4    SALRVEEVQNVINAMQKILECP 25
            + L+ ++  NVI   +K + CP
Sbjct: 6632 TTLQTKQHLNVILWQKKTIPCP 6567



 Score = 17.7 bits (34), Expect = 3.4
 Identities = 5/11 (45%), Positives = 8/11 (72%)
 Frame = +3

Query: 49    CCPSWSTVVRS 59
             C P+W+T + S
Sbjct: 73401 CTPTWATELDS 73433



 Score = 17.7 bits (34), Expect = 3.4
 Identities = 5/11 (45%), Positives = 7/11 (63%)
 Frame = +1

Query: 49    CCPSWSTVVRS 59
             C P WS + +S
Sbjct: 68539 CRPGWSAMAQS 68571



 Score = 17.7 bits (34), Expect = 3.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -1

Query: 46    VLLCCPSWS 54
             VL C P WS
Sbjct: 14989 VLPCWPGWS 14963



 Score = 17.7 bits (34), Expect = 3.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +2

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 59129 CAPAWAT 59149



 Score = 17.7 bits (34), Expect = 3.4
 Identities = 6/17 (35%), Positives = 10/17 (58%)
 Frame = +3

Query: 11    VQNVINAMQKILECPIC 27
             V ++I   + +L C IC
Sbjct: 49620 VSSLIYHFRSLLNCQIC 49670



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +2

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 78719 CTPAWAT 78739



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -3

Query: 49   CCPSWST 55
            C P+W+T
Sbjct: 2855 CTPAWAT 2835



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +2

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 77345 CTPAWAT 77365



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 76732 CTPAWAT 76752



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 71164 CTPAWAT 71184



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 66763 CTPAWAT 66783



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +2

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 64655 CTPAWAT 64675



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 64000 CIPAWAT 64020



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -2

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 25689 CTPAWAT 25669



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 51244 CTPAWAT 51264



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 31318 CTPAWAT 31298



 Score = 17.3 bits (33), Expect(2) = 0.094
 Identities = 10/34 (29%), Positives = 13/34 (38%)
 Frame = +3

Query: 17    AMQKILECPICLELIKEPVSTKCDHIFCKVLLCC 50
             AMQ  L  P           +KC H+F    + C
Sbjct: 45972 AMQSPLNHPAVAPFSHLS*YSKCRHVFAIGEMMC 46073



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -2

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 39786 CTPAWAT 39766



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 27670 CIPAWAT 27690



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 13498 CTPAWAT 13518



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -3

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 70139 CIPAWAT 70119



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -3

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 74132 CTPAWAT 74112



 Score = 17.3 bits (33), Expect = 4.4
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 80512 CTPAWAT 80492



 Score = 16.9 bits (32), Expect = 5.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 42    IFCKVLLC 49
             +FC VL C
Sbjct: 80445 VFCFVLFC 80468



 Score = 16.9 bits (32), Expect = 5.7
 Identities = 4/8 (50%), Positives = 6/8 (75%)
 Frame = -1

Query: 49    CCPSWSTV 56
             C P+W T+
Sbjct: 10195 CTPAWPTL 10172



 Score = 16.9 bits (32), Expect = 5.7
 Identities = 5/11 (45%), Positives = 7/11 (63%)
 Frame = +3

Query: 45    KVLLCCPSWST 55
             K+  C P+W T
Sbjct: 44973 KLCHCIPAWVT 45005



 Score = 16.9 bits (32), Expect = 5.7
 Identities = 3/10 (30%), Positives = 7/10 (70%)
 Frame = -2

Query: 49    CCPSWSTVVR 58
             C P+W+ + +
Sbjct: 55026 CTPAWAKIAK 54997



 Score = 16.9 bits (32), Expect = 5.7
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -2

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 62820 CTPAWET 62800



 Score = 16.5 bits (31), Expect = 7.5
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = +3

Query: 50    CPSWS 54
             CP WS
Sbjct: 74670 CPGWS 74684



 Score = 16.5 bits (31), Expect = 7.5
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = -1

Query: 50    CPSWS 54
             CP WS
Sbjct: 12301 CPGWS 12287



 Score = 16.5 bits (31), Expect = 7.5
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = +1

Query: 49    CCPSWST 55
             C P W+T
Sbjct: 64369 CTPPWAT 64389



 Score = 16.5 bits (31), Expect = 7.5
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = +3

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 36468 CPPAWAT 36488



 Score = 16.5 bits (31), Expect = 7.5
 Identities = 4/7 (57%), Positives = 6/7 (85%)
 Frame = -1

Query: 49    CCPSWST 55
             C P+W+T
Sbjct: 57826 CDPAWAT 57806



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -3

Query: 49   CCPSWST 55
            C P+W T
Sbjct: 3527 CTPAWVT 3507



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = +3

Query: 49    CCPSWST 55
             C P W+T
Sbjct: 67182 CTPVWAT 67202



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = +3

Query: 45    KVLLCCPSWSTVVRS 59
             +VLL CP    V +S
Sbjct: 60963 RVLLYCPG*HAVPQS 61007



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -2

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 20586 CTPAWLT 20566



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = +1

Query: 45    KVLLCCPSWS 54
             +V  C P WS
Sbjct: 58246 RVSPCWPGWS 58275



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -2

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 33840 CIPAWVT 33820



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = -2

Query: 45    KVLLCCPSWS 54
             +V  C P WS
Sbjct: 34728 RVSPCWPGWS 34699



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = -3

Query: 49    CCPSW 53
             C PSW
Sbjct: 43490 CTPSW 43476



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -1

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 46129 CTPAWVT 46109



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -3

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 53780 CTPTWVT 53760



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -2

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 56097 CTPAWVT 56077



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = -3

Query: 45    KVLLCCPSWS 54
             +V  C P WS
Sbjct: 63866 RVSPCWPGWS 63837



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = +2

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 13682 CTPAWVT 13702



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = +3

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 13173 CTPAWVT 13193



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = +1

Query: 49    CCPSWST 55
             C P+W T
Sbjct: 11602 CTPAWVT 11622



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 4/7 (57%)
 Frame = +3

Query: 49    CCPSWST 55
             C P W T
Sbjct: 11448 CTPDWPT 11468



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = +2

Query: 49   CCPSWST 55
            C P+W T
Sbjct: 9329 CTPAWVT 9349



 Score = 16.2 bits (30), Expect = 9.8
 Identities = 4/7 (57%), Positives = 5/7 (71%)
 Frame = -1

Query: 49    CCPSWST 55
             C P W+T
Sbjct: 72274 CMPVWAT 72254


Lambda     K      H
   0.327    0.137    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9528
Number of Sequences: 0
Number of extensions: 317
Number of successful extensions: 172
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 172
length of query: 59
length of database: 27,030
effective HSP length: 35
effective length of query: 24
effective length of database: 26,995
effective search space:   647880
effective search space used:   647880
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 30 (17.0 bits)
S2: 30 (16.2 bits)

END