Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_009235.1
Subject Sequence ID: ENSG00000012048
Subject Sequence type: 3

Query= gi|6552319|ref|NP_009235.1| breast cancer 1, early onset
isoform BRCA1-delta11b; breast-ovarian cancer, included [Homo sapiens]
         (759 letters)

>ENSG00000012048
          Length = 81091

 Score =  165 bits (418), Expect = 3e-43
 Identities = 88/107 (82%), Positives = 89/107 (83%)
 Frame = -3

Query: 455   EGTPYLESGISLFXXXXXXXXXXXXXXXXARVGNIPSSTSALKVPQLKVAESAQGPAAAH 514
             EGTPYLESGISLF                ARVGNIPSSTSALKVPQLKVAESAQ PAAAH
Sbjct: 26939 EGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAH 26760

Query: 515   TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLV 561
             TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEF+ V
Sbjct: 26759 TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFVSV 26619



 Score =  137 bits (345), Expect = 8e-35
 Identities = 64/66 (96%), Positives = 65/66 (98%)
 Frame = -1

Query: 389   VERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 448
             + RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY
Sbjct: 30229 LSRSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 30050

Query: 449   LPRQDL 454
             LPRQDL
Sbjct: 30049 LPRQDL 30032



 Score =  112 bits (280), Expect = 3e-27
 Identities = 56/58 (96%), Positives = 57/58 (98%)
 Frame = -1

Query: 292   QQRDTMQHNLIKLQQEMAELEAVLEQHGSQPPNSYPSIISDSSALEDLRNPEQSTSEK 349
             +QRDTMQHNLIKLQQEMAELEAVLEQHGSQP NSYPSIISDSSALEDLRNPEQSTSEK
Sbjct: 38278 KQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEK 38105



 Score = 95.5 bits (236), Expect = 4e-22
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = -1

Query: 102   ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 147
             ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL
Sbjct: 59959 ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 59822



 Score = 90.9 bits (224), Expect = 9e-21
 Identities = 41/41 (100%), Positives = 41/41 (100%)
 Frame = -2

Query: 719  AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 759
            AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
Sbjct: 1503 AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 1381



 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 46/73 (63%), Positives = 51/73 (69%), Gaps = 2/73 (2%)
 Frame = -3

Query: 224   AACEFSETDVTNTEHRQPSNNDLNTTEKRVAERHPEKYQGEAASGCESE-TSVSEDCSGL 282
             AACEFSETDVTNTEH QPSNNDLNTTEKR AERHPEKYQG + S    E    +   S L
Sbjct: 50561 AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL 50382

Query: 283   SSQ-SDILTTQQR 294
               + S +L T+ R
Sbjct: 50381 QHENSSLLLTKDR 50343



 Score = 84.7 bits (208), Expect = 6e-19
 Identities = 42/42 (100%), Positives = 42/42 (100%)
 Frame = -3

Query: 350   VLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 391
             VLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER
Sbjct: 32312 VLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 32187



 Score = 71.2 bits (173), Expect = 7e-15
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = -3

Query: 148   QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG 183
             QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG
Sbjct: 55580 QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG 55473



 Score = 65.1 bits (157), Expect = 5e-13
 Identities = 28/30 (93%), Positives = 30/30 (100%)
 Frame = -1

Query: 627   EHDFEVRGDVVNGRNHQGPKRARESQDRKI 656
             +HDFEVRGDVVNGRNHQGPKRARESQDRK+
Sbjct: 12838 QHDFEVRGDVVNGRNHQGPKRARESQDRKV 12749



 Score = 62.0 bits (149), Expect = 4e-12
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -3

Query: 263   GEAASGCESETSVSEDCSGLSSQSDILTTQ 292
             GEAASGCESETSVSEDCSGLSSQSDILTTQ
Sbjct: 46733 GEAASGCESETSVSEDCSGLSSQSDILTTQ 46644



 Score = 62.0 bits (149), Expect = 4e-12
 Identities = 27/30 (90%), Positives = 28/30 (93%)
 Frame = -2

Query: 42    IFCKFCMLKLLNQKKGPSQCPLCKNDITKR 71
             I  +FCMLKLLNQKKGPSQCPLCKNDITKR
Sbjct: 62244 IIYRFCMLKLLNQKKGPSQCPLCKNDITKR 62155



 Score = 60.5 bits (145), Expect = 1e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -1

Query: 71    RSLQESTRFSQLVEELLKIICAFQLDTGLE 100
             RSLQESTRFSQLVEELLKIICAFQLDTGLE
Sbjct: 60658 RSLQESTRFSQLVEELLKIICAFQLDTGLE 60569



 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 27/31 (87%), Positives = 27/31 (87%)
 Frame = -3

Query: 583   VVMKTDAEFVCERTLKYFLGIAGGKWVVSYF 613
             V    DAEFVCERTLKYFLGIAGGKWVVSYF
Sbjct: 19667 VFHSADAEFVCERTLKYFLGIAGGKWVVSYF 19575



 Score = 53.9 bits (128), Expect = 1e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = -3

Query: 674  DQLEWMVQLCGASVVKELSSFTLGT 698
            DQLEWMVQLCGASVVKELSSFTLGT
Sbjct: 4895 DQLEWMVQLCGASVVKELSSFTLGT 4821



 Score = 53.5 bits (127), Expect = 2e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -2

Query: 198   SVGDQELLQITPQGTRDEISLDSAKK 223
             SVGDQELLQITPQGTRDEISLDSAKK
Sbjct: 51624 SVGDQELLQITPQGTRDEISLDSAKK 51547



 Score = 53.5 bits (127), Expect = 2e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -3

Query: 1     MDLSALRVEEVQNVINAMQKILECPI 26
             MDLSALRVEEVQNVINAMQKILECPI
Sbjct: 79796 MDLSALRVEEVQNVINAMQKILECPI 79719



 Score = 50.1 bits (118), Expect = 2e-08
 Identities = 21/30 (70%), Positives = 22/30 (73%)
 Frame = -1

Query: 699  GVHPIVVVQPDAWTEDNGFHAIGQMCEAPV 728
            GVHPIVVVQPDAWTEDNGFH     C   +
Sbjct: 3403 GVHPIVVVQPDAWTEDNGFHGKVPACTCAI 3314



 Score = 45.8 bits (107), Expect = 3e-07
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = -1

Query: 655  KIFRGLEICCYGPFTNMPT 673
            +IFRGLEICCYGPFTNMPT
Sbjct: 6820 QIFRGLEICCYGPFTNMPT 6764



 Score = 44.7 bits (104), Expect = 7e-07
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = -2

Query: 25    PICLELIKEPVSTKCDHIFCK 45
             P  LELIKEPVSTKCDHIFCK
Sbjct: 71487 PASLELIKEPVSTKCDHIFCK 71425



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = -1

Query: 182   LGSDSSEDTVNKATYC 197
             LGSDSSEDTVNKATYC
Sbjct: 52993 LGSDSSEDTVNKATYC 52946



 Score = 30.4 bits (67), Expect = 0.014
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = -1

Query: 559   MLVYKFARKHXXXXXXXXXXXXXXVVMKT 587
             MLVYKFARKH              VVMKT
Sbjct: 23395 MLVYKFARKHHITLTNLITEETTHVVMKT 23309



 Score = 28.5 bits (62), Expect = 0.055
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -2

Query: 615   VTQSIKERKMLNE 627
             VTQSIKERKMLNE
Sbjct: 19071 VTQSIKERKMLNE 19033



 Score = 21.2 bits (43), Expect = 8.8
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +3

Query: 591   FVCERTLKYFLGIA 604
             F+CE TL Y+L ++
Sbjct: 49728 FICEGTLLYYLWLS 49769


Lambda     K      H
   0.312    0.128    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64,417
Number of Sequences: 0
Number of extensions: 903
Number of successful extensions: 24
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of query: 759
length of database: 27,030
effective HSP length: 66
effective length of query: 693
effective length of database: 26,964
effective search space: 18686052
effective search space used: 18686052
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 43 (21.2 bits)

END