Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_009233.1
Subject Sequence ID: ENSG00000012048
Subject Sequence type: 3

Query= gi|6552315|ref|NP_009233.1| breast cancer 1, early onset
isoform BRCA1-delta9-10; breast-ovarian cancer, included [Homo
sapiens]
         (1822 letters)

>ENSG00000012048
          Length = 81091

 Score = 2123 bits (5501), Expect = 0.0
 Identities = 1069/1143 (93%), Positives = 1069/1143 (93%)
 Frame = -3

Query: 183   AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL 242
             AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL
Sbjct: 50561 AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL 50382

Query: 243   QHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLN 302
             QHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLN
Sbjct: 50381 QHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLN 50202

Query: 303   ADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLXXXXXXXXXX 362
             ADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELL          
Sbjct: 50201 ADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGES 50022

Query: 363   XXNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGK 422
               NAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGK
Sbjct: 50021 ESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGK 49842

Query: 423   TYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADL 482
             TYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADL
Sbjct: 49841 TYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADL 49662

Query: 483   AVQKTPEMIXXXXXXXXXXXXVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTK 542
             AVQKTPEMI            VMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTK
Sbjct: 49661 AVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTK 49482

Query: 543   AEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDX 602
             AEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQID 
Sbjct: 49481 AEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDS 49302

Query: 603   XXXXXXXXXXXYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLT 662
                        YNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLT
Sbjct: 49301 CSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLT 49122

Query: 663   NAPGSFTKCSNTSELKEFVNPSLPRXXXXXXXXTVKVSNNAEDPKDLMLSGERVLQTERS 722
             NAPGSFTKCSNTSELKEFVNPSLPR        TVKVSNNAEDPKDLMLSGERVLQTERS
Sbjct: 49121 NAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERS 48942

Query: 723   VESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNR 782
             VESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNR
Sbjct: 48941 VESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNR 48762

Query: 783   NDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECA 842
             NDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECA
Sbjct: 48761 NDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECA 48582

Query: 843   TFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAK 902
             TFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAK
Sbjct: 48581 TFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAK 48402

Query: 903   CSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENF 962
             CSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENF
Sbjct: 48401 CSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENF 48222

Query: 963   EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGS 1022
             EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGS
Sbjct: 48221 EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGS 48042

Query: 1023  SDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTD 1082
             SDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTD
Sbjct: 48041 SDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTD 47862

Query: 1083  FSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQK 1142
             FSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQK
Sbjct: 47861 FSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQK 47682

Query: 1143  GELSRSPSPFTHTHLAQGYRRGAKKXXXXXXXXXXXXXXXPCFQHLLFGKVNNIPSQSTR 1202
             GELSRSPSPFTHTHLAQGYRRGAKK               PCFQHLLFGKVNNIPSQSTR
Sbjct: 47681 GELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTR 47502

Query: 1203  HSTVATECLSXXXXXXXXXXXXXXXDCSNQVILAKASQEHHLSEETKCSASLFSSQCSEL 1262
             HSTVATECLS               DCSNQVILAKASQEHHLSEETKCSASLFSSQCSEL
Sbjct: 47501 HSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSEL 47322

Query: 1263  EDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDS 1322
             EDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDS
Sbjct: 47321 EDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDS 47142

Query: 1323  NLG 1325
             NLG
Sbjct: 47141 NLG 47133



 Score =  167 bits (422), Expect = 3e-43
 Identities = 89/107 (83%), Positives = 90/107 (84%)
 Frame = -3

Query: 1518  EGTPYLESGISLFXXXXXXXXXXXXXXXXARVGNIPSSTSALKVPQLKVAESAQSPAAAH 1577
             EGTPYLESGISLF                ARVGNIPSSTSALKVPQLKVAESAQSPAAAH
Sbjct: 26939 EGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAH 26760

Query: 1578  TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLV 1624
             TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEF+ V
Sbjct: 26759 TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFVSV 26619



 Score =  137 bits (345), Expect = 2e-34
 Identities = 64/66 (96%), Positives = 65/66 (98%)
 Frame = -1

Query: 1452  VERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 1511
             + RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY
Sbjct: 30229 LSRSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 30050

Query: 1512  LPRQDL 1517
             LPRQDL
Sbjct: 30049 LPRQDL 30032



 Score = 95.5 bits (236), Expect = 9e-22
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = -1

Query: 102   ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 147
             ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL
Sbjct: 59959 ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 59822



 Score = 90.9 bits (224), Expect = 2e-20
 Identities = 41/41 (100%), Positives = 41/41 (100%)
 Frame = -2

Query: 1782 AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 1822
            AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
Sbjct: 1503 AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 1381



 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = -3

Query: 1411  KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 1454
             KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER
Sbjct: 32318 KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 32187



 Score = 87.4 bits (215), Expect = 3e-19
 Identities = 45/60 (75%), Positives = 46/60 (76%)
 Frame = -1

Query: 1354  QQRDTMQHNLIKLQQEMAELEAVLEQHGSQXXXXXXXXXXXXXALEDLRNPEQSTSEKAV 1413
             +QRDTMQHNLIKLQQEMAELEAVLEQHGSQ             ALEDLRNPEQSTSEK V
Sbjct: 38278 KQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKGV 38099



 Score = 68.9 bits (167), Expect = 9e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = -3

Query: 148   QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIEL 182
             QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIEL
Sbjct: 55580 QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIEL 55476



 Score = 65.1 bits (157), Expect = 1e-12
 Identities = 28/30 (93%), Positives = 30/30 (100%)
 Frame = -1

Query: 1690  EHDFEVRGDVVNGRNHQGPKRARESQDRKI 1719
             +HDFEVRGDVVNGRNHQGPKRARESQDRK+
Sbjct: 12838 QHDFEVRGDVVNGRNHQGPKRARESQDRKV 12749



 Score = 62.0 bits (149), Expect = 1e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -3

Query: 1325  GEAASGCESETSVSEDCSGLSSQSDILTTQ 1354
             GEAASGCESETSVSEDCSGLSSQSDILTTQ
Sbjct: 46733 GEAASGCESETSVSEDCSGLSSQSDILTTQ 46644



 Score = 62.0 bits (149), Expect = 1e-11
 Identities = 27/30 (90%), Positives = 28/30 (93%)
 Frame = -2

Query: 42    IFCKFCMLKLLNQKKGPSQCPLCKNDITKR 71
             I  +FCMLKLLNQKKGPSQCPLCKNDITKR
Sbjct: 62244 IIYRFCMLKLLNQKKGPSQCPLCKNDITKR 62155



 Score = 60.5 bits (145), Expect = 3e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -1

Query: 71    RSLQESTRFSQLVEELLKIICAFQLDTGLE 100
             RSLQESTRFSQLVEELLKIICAFQLDTGLE
Sbjct: 60658 RSLQESTRFSQLVEELLKIICAFQLDTGLE 60569



 Score = 59.7 bits (143), Expect = 6e-11
 Identities = 27/31 (87%), Positives = 27/31 (87%)
 Frame = -3

Query: 1646  VVMKTDAEFVCERTLKYFLGIAGGKWVVSYF 1676
             V    DAEFVCERTLKYFLGIAGGKWVVSYF
Sbjct: 19667 VFHSADAEFVCERTLKYFLGIAGGKWVVSYF 19575



 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = -3

Query: 1737 DQLEWMVQLCGASVVKELSSFTLGT 1761
            DQLEWMVQLCGASVVKELSSFTLGT
Sbjct: 4895 DQLEWMVQLCGASVVKELSSFTLGT 4821



 Score = 53.5 bits (127), Expect = 4e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -3

Query: 1     MDLSALRVEEVQNVINAMQKILECPI 26
             MDLSALRVEEVQNVINAMQKILECPI
Sbjct: 79796 MDLSALRVEEVQNVINAMQKILECPI 79719



 Score = 50.1 bits (118), Expect = 4e-08
 Identities = 21/30 (70%), Positives = 22/30 (73%)
 Frame = -1

Query: 1762 GVHPIVVVQPDAWTEDNGFHAIGQMCEAPV 1791
            GVHPIVVVQPDAWTEDNGFH     C   +
Sbjct: 3403 GVHPIVVVQPDAWTEDNGFHGKVPACTCAI 3314



 Score = 45.8 bits (107), Expect = 8e-07
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = -1

Query: 1718 KIFRGLEICCYGPFTNMPT 1736
            +IFRGLEICCYGPFTNMPT
Sbjct: 6820 QIFRGLEICCYGPFTNMPT 6764



 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = -2

Query: 25    PICLELIKEPVSTKCDHIFCK 45
             P  LELIKEPVSTKCDHIFCK
Sbjct: 71487 PASLELIKEPVSTKCDHIFCK 71425



 Score = 30.4 bits (67), Expect = 0.037
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = -1

Query: 1622  MLVYKFARKHXXXXXXXXXXXXXXVVMKT 1650
             MLVYKFARKH              VVMKT
Sbjct: 23395 MLVYKFARKHHITLTNLITEETTHVVMKT 23309



 Score = 28.5 bits (62), Expect = 0.14
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -2

Query: 1678  VTQSIKERKMLNE 1690
             VTQSIKERKMLNE
Sbjct: 19071 VTQSIKERKMLNE 19033



 Score = 23.5 bits (49), Expect = 4.5
 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 2/36 (5%)
 Frame = +2

Query: 936   PY--RIPPLFPIKSFVKTKCKKNLLEENFEEHSMSP 969
             PY  ++PPL P+K +        L   +  EH + P
Sbjct: 80837 PYASQVPPLPPVKEYPSVSFGNPLSHASTPEHHLGP 80944



 Score = 22.7 bits (47), Expect = 7.6
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%)
 Frame = -2

Query: 1324  LGEAASGCESETSVSEDC--SGLSSQ 1347
             LG  A  C S T   EDC  SG+  Q
Sbjct: 58644 LGAVAHACNSSTRRLEDCLSSGVQDQ 58567


Lambda     K      H
   0.310    0.127    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 152,506
Number of Sequences: 0
Number of extensions: 2120
Number of successful extensions: 29
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of query: 1822
length of database: 27,030
effective HSP length: 73
effective length of query: 1749
effective length of database: 26,957
effective search space: 47147793
effective search space used: 47147793
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 46 (22.3 bits)

END