Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_009232.1
Subject Sequence ID: ENSG00000012048
Subject Sequence type: 3

Query= gi|6552313|ref|NP_009232.1| breast cancer 1, early onset
isoform BRCA1-delta15-17; breast-ovarian cancer, included [Homo
sapiens]
         (1496 letters)

>ENSG00000012048
          Length = 81091

 Score = 2123 bits (5501), Expect = 0.0
 Identities = 1069/1143 (93%), Positives = 1069/1143 (93%)
 Frame = -3

Query: 224   AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL 283
             AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL
Sbjct: 50561 AACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSL 50382

Query: 284   QHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLN 343
             QHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLN
Sbjct: 50381 QHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLN 50202

Query: 344   ADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLXXXXXXXXXX 403
             ADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELL          
Sbjct: 50201 ADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGES 50022

Query: 404   XXNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGK 463
               NAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGK
Sbjct: 50021 ESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGK 49842

Query: 464   TYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADL 523
             TYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADL
Sbjct: 49841 TYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADL 49662

Query: 524   AVQKTPEMIXXXXXXXXXXXXVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTK 583
             AVQKTPEMI            VMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTK
Sbjct: 49661 AVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTK 49482

Query: 584   AEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDX 643
             AEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQID 
Sbjct: 49481 AEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDS 49302

Query: 644   XXXXXXXXXXXYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLT 703
                        YNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLT
Sbjct: 49301 CSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLT 49122

Query: 704   NAPGSFTKCSNTSELKEFVNPSLPRXXXXXXXXTVKVSNNAEDPKDLMLSGERVLQTERS 763
             NAPGSFTKCSNTSELKEFVNPSLPR        TVKVSNNAEDPKDLMLSGERVLQTERS
Sbjct: 49121 NAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERS 48942

Query: 764   VESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNR 823
             VESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNR
Sbjct: 48941 VESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNR 48762

Query: 824   NDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECA 883
             NDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECA
Sbjct: 48761 NDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECA 48582

Query: 884   TFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAK 943
             TFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAK
Sbjct: 48581 TFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAK 48402

Query: 944   CSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENF 1003
             CSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENF
Sbjct: 48401 CSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENF 48222

Query: 1004  EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGS 1063
             EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGS
Sbjct: 48221 EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGS 48042

Query: 1064  SDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTD 1123
             SDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTD
Sbjct: 48041 SDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTD 47862

Query: 1124  FSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQK 1183
             FSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQK
Sbjct: 47861 FSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQK 47682

Query: 1184  GELSRSPSPFTHTHLAQGYRRGAKKXXXXXXXXXXXXXXXPCFQHLLFGKVNNIPSQSTR 1243
             GELSRSPSPFTHTHLAQGYRRGAKK               PCFQHLLFGKVNNIPSQSTR
Sbjct: 47681 GELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTR 47502

Query: 1244  HSTVATECLSXXXXXXXXXXXXXXXDCSNQVILAKASQEHHLSEETKCSASLFSSQCSEL 1303
             HSTVATECLS               DCSNQVILAKASQEHHLSEETKCSASLFSSQCSEL
Sbjct: 47501 HSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSEL 47322

Query: 1304  EDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDS 1363
             EDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDS
Sbjct: 47321 EDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDS 47142

Query: 1364  NLG 1366
             NLG
Sbjct: 47141 NLG 47133



 Score = 95.5 bits (236), Expect = 8e-22
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = -1

Query: 102   ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 147
             ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL
Sbjct: 59959 ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSL 59822



 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = -3

Query: 1452  KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 1495
             KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER
Sbjct: 32318 KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 32187



 Score = 87.4 bits (215), Expect = 2e-19
 Identities = 45/60 (75%), Positives = 46/60 (76%)
 Frame = -1

Query: 1395  QQRDTMQHNLIKLQQEMAELEAVLEQHGSQXXXXXXXXXXXXXALEDLRNPEQSTSEKAV 1454
             +QRDTMQHNLIKLQQEMAELEAVLEQHGSQ             ALEDLRNPEQSTSEK V
Sbjct: 38278 KQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKGV 38099



 Score = 71.2 bits (173), Expect = 2e-14
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = -3

Query: 148   QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG 183
             QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG
Sbjct: 55580 QETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELG 55473



 Score = 62.0 bits (149), Expect = 9e-12
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -3

Query: 1366  GEAASGCESETSVSEDCSGLSSQSDILTTQ 1395
             GEAASGCESETSVSEDCSGLSSQSDILTTQ
Sbjct: 46733 GEAASGCESETSVSEDCSGLSSQSDILTTQ 46644



 Score = 62.0 bits (149), Expect = 9e-12
 Identities = 27/30 (90%), Positives = 28/30 (93%)
 Frame = -2

Query: 42    IFCKFCMLKLLNQKKGPSQCPLCKNDITKR 71
             I  +FCMLKLLNQKKGPSQCPLCKNDITKR
Sbjct: 62244 IIYRFCMLKLLNQKKGPSQCPLCKNDITKR 62155



 Score = 60.5 bits (145), Expect = 3e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -1

Query: 71    RSLQESTRFSQLVEELLKIICAFQLDTGLE 100
             RSLQESTRFSQLVEELLKIICAFQLDTGLE
Sbjct: 60658 RSLQESTRFSQLVEELLKIICAFQLDTGLE 60569



 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -2

Query: 198   SVGDQELLQITPQGTRDEISLDSAKK 223
             SVGDQELLQITPQGTRDEISLDSAKK
Sbjct: 51624 SVGDQELLQITPQGTRDEISLDSAKK 51547



 Score = 53.5 bits (127), Expect = 3e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = -3

Query: 1     MDLSALRVEEVQNVINAMQKILECPI 26
             MDLSALRVEEVQNVINAMQKILECPI
Sbjct: 79796 MDLSALRVEEVQNVINAMQKILECPI 79719



 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 19/21 (90%), Positives = 19/21 (90%)
 Frame = -2

Query: 25    PICLELIKEPVSTKCDHIFCK 45
             P  LELIKEPVSTKCDHIFCK
Sbjct: 71487 PASLELIKEPVSTKCDHIFCK 71425



 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = -1

Query: 182   LGSDSSEDTVNKATYC 197
             LGSDSSEDTVNKATYC
Sbjct: 52993 LGSDSSEDTVNKATYC 52946



 Score = 23.5 bits (49), Expect = 3.6
 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 2/36 (5%)
 Frame = +2

Query: 977   PY--RIPPLFPIKSFVKTKCKKNLLEENFEEHSMSP 1010
             PY  ++PPL P+K +        L   +  EH + P
Sbjct: 80837 PYASQVPPLPPVKEYPSVSFGNPLSHASTPEHHLGP 80944



 Score = 22.7 bits (47), Expect = 6.2
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%)
 Frame = -2

Query: 1365  LGEAASGCESETSVSEDC--SGLSSQ 1388
             LG  A  C S T   EDC  SG+  Q
Sbjct: 58644 LGAVAHACNSSTRRLEDCLSSGVQDQ 58567


Lambda     K      H
   0.308    0.125    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 122,909
Number of Sequences: 0
Number of extensions: 1696
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of query: 1496
length of database: 27,030
effective HSP length: 72
effective length of query: 1424
effective length of database: 26,958
effective search space: 38388192
effective search space used: 38388192
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 45 (21.9 bits)

END