Show SIM4 / tBLASTn alignment result

PARAMETERS:
Query Sequence ID: NP_009228.1
Subject Sequence ID: ENSG00000012048
Subject Sequence type: 3

Query= gi|6552305|ref|NP_009228.1| breast cancer 1, early onset
isoform BRCA1-delta2-10; breast-ovarian cancer, included [Homo
sapiens]
         (1567 letters)

>ENSG00000012048
          Length = 81091

 Score = 1973 bits (5112), Expect = 0.0
 Identities = 996/1070 (93%), Positives = 996/1070 (93%)
 Frame = -3

Query: 1     MNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQ 60
             MNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQ
Sbjct: 50342 MNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQ 50163

Query: 61    KLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLXXXXXXXXXXXXNAKVADVLDVL 120
             KLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELL            NAKVADVLDVL
Sbjct: 50162 KLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVL 49983

Query: 121   NEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSH 180
             NEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSH
Sbjct: 49982 NEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSH 49803

Query: 181   VTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMIXXXX 240
             VTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMI    
Sbjct: 49802 VTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGT 49623

Query: 241   XXXXXXXXVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMEL 300
                     VMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMEL
Sbjct: 49622 NQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMEL 49443

Query: 301   ELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDXXXXXXXXXXXXYN 360
             ELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQID            YN
Sbjct: 49442 ELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYN 49263

Query: 361   QMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTS 420
             QMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTS
Sbjct: 49262 QMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTS 49083

Query: 421   ELKEFVNPSLPRXXXXXXXXTVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTD 480
             ELKEFVNPSLPR        TVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTD
Sbjct: 49082 ELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTD 48903

Query: 481   YGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHE 540
             YGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHE
Sbjct: 48902 YGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHE 48723

Query: 541   VNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQS 600
             VNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQS
Sbjct: 48722 VNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQS 48543

Query: 601   PKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSS 660
             PKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSS
Sbjct: 48542 PKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSS 48363

Query: 661   QFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGN 720
             QFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGN
Sbjct: 48362 QFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGN 48183

Query: 721   ENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNR 780
             ENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNR
Sbjct: 48182 ENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNR 48003

Query: 781   GPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQP 840
             GPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQP
Sbjct: 48002 GPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQP 47823

Query: 841   MGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHT 900
             MGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHT
Sbjct: 47822 MGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHT 47643

Query: 901   HLAQGYRRGAKKXXXXXXXXXXXXXXXPCFQHLLFGKVNNIPSQSTRHSTVATECLSXXX 960
             HLAQGYRRGAKK               PCFQHLLFGKVNNIPSQSTRHSTVATECLS   
Sbjct: 47642 HLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNT 47463

Query: 961   XXXXXXXXXXXXDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPF 1020
                         DCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPF
Sbjct: 47462 EENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPF 47283

Query: 1021  LIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLG 1070
             LIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLG
Sbjct: 47282 LIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLG 47133



 Score =  167 bits (422), Expect = 2e-43
 Identities = 89/107 (83%), Positives = 90/107 (84%)
 Frame = -3

Query: 1263  EGTPYLESGISLFXXXXXXXXXXXXXXXXARVGNIPSSTSALKVPQLKVAESAQSPAAAH 1322
             EGTPYLESGISLF                ARVGNIPSSTSALKVPQLKVAESAQSPAAAH
Sbjct: 26939 EGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAH 26760

Query: 1323  TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLV 1369
             TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEF+ V
Sbjct: 26759 TTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFVSV 26619



 Score =  137 bits (345), Expect = 2e-34
 Identities = 64/66 (96%), Positives = 65/66 (98%)
 Frame = -1

Query: 1197  VERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 1256
             + RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY
Sbjct: 30229 LSRSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY 30050

Query: 1257  LPRQDL 1262
             LPRQDL
Sbjct: 30049 LPRQDL 30032



 Score = 90.9 bits (224), Expect = 2e-20
 Identities = 41/41 (100%), Positives = 41/41 (100%)
 Frame = -2

Query: 1527 AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 1567
            AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY
Sbjct: 1503 AIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 1381



 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = -3

Query: 1156  KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 1199
             KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER
Sbjct: 32318 KAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVER 32187



 Score = 87.4 bits (215), Expect = 2e-19
 Identities = 45/60 (75%), Positives = 46/60 (76%)
 Frame = -1

Query: 1099  QQRDTMQHNLIKLQQEMAELEAVLEQHGSQXXXXXXXXXXXXXALEDLRNPEQSTSEKAV 1158
             +QRDTMQHNLIKLQQEMAELEAVLEQHGSQ             ALEDLRNPEQSTSEK V
Sbjct: 38278 KQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKGV 38099



 Score = 65.1 bits (157), Expect = 1e-12
 Identities = 28/30 (93%), Positives = 30/30 (100%)
 Frame = -1

Query: 1435  EHDFEVRGDVVNGRNHQGPKRARESQDRKI 1464
             +HDFEVRGDVVNGRNHQGPKRARESQDRK+
Sbjct: 12838 QHDFEVRGDVVNGRNHQGPKRARESQDRKV 12749



 Score = 62.0 bits (149), Expect = 1e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = -3

Query: 1070  GEAASGCESETSVSEDCSGLSSQSDILTTQ 1099
             GEAASGCESETSVSEDCSGLSSQSDILTTQ
Sbjct: 46733 GEAASGCESETSVSEDCSGLSSQSDILTTQ 46644



 Score = 59.7 bits (143), Expect = 5e-11
 Identities = 27/31 (87%), Positives = 27/31 (87%)
 Frame = -3

Query: 1391  VVMKTDAEFVCERTLKYFLGIAGGKWVVSYF 1421
             V    DAEFVCERTLKYFLGIAGGKWVVSYF
Sbjct: 19667 VFHSADAEFVCERTLKYFLGIAGGKWVVSYF 19575



 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = -3

Query: 1482 DQLEWMVQLCGASVVKELSSFTLGT 1506
            DQLEWMVQLCGASVVKELSSFTLGT
Sbjct: 4895 DQLEWMVQLCGASVVKELSSFTLGT 4821



 Score = 50.1 bits (118), Expect = 4e-08
 Identities = 21/30 (70%), Positives = 22/30 (73%)
 Frame = -1

Query: 1507 GVHPIVVVQPDAWTEDNGFHAIGQMCEAPV 1536
            GVHPIVVVQPDAWTEDNGFH     C   +
Sbjct: 3403 GVHPIVVVQPDAWTEDNGFHGKVPACTCAI 3314



 Score = 45.8 bits (107), Expect = 7e-07
 Identities = 18/19 (94%), Positives = 19/19 (100%)
 Frame = -1

Query: 1463 KIFRGLEICCYGPFTNMPT 1481
            +IFRGLEICCYGPFTNMPT
Sbjct: 6820 QIFRGLEICCYGPFTNMPT 6764



 Score = 30.4 bits (67), Expect = 0.031
 Identities = 15/29 (51%), Positives = 15/29 (51%)
 Frame = -1

Query: 1367  MLVYKFARKHXXXXXXXXXXXXXXVVMKT 1395
             MLVYKFARKH              VVMKT
Sbjct: 23395 MLVYKFARKHHITLTNLITEETTHVVMKT 23309



 Score = 28.5 bits (62), Expect = 0.12
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -2

Query: 1423  VTQSIKERKMLNE 1435
             VTQSIKERKMLNE
Sbjct: 19071 VTQSIKERKMLNE 19033



 Score = 23.5 bits (49), Expect = 3.8
 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 2/36 (5%)
 Frame = +2

Query: 681   PY--RIPPLFPIKSFVKTKCKKNLLEENFEEHSMSP 714
             PY  ++PPL P+K +        L   +  EH + P
Sbjct: 80837 PYASQVPPLPPVKEYPSVSFGNPLSHASTPEHHLGP 80944



 Score = 22.7 bits (47), Expect = 6.5
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%)
 Frame = -2

Query: 1069  LGEAASGCESETSVSEDC--SGLSSQ 1092
             LG  A  C S T   EDC  SG+  Q
Sbjct: 58644 LGAVAHACNSSTRRLEDCLSSGVQDQ 58567


Lambda     K      H
   0.309    0.127    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 128,025
Number of Sequences: 0
Number of extensions: 1661
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of query: 1567
length of database: 27,030
effective HSP length: 72
effective length of query: 1495
effective length of database: 26,958
effective search space: 40302210
effective search space used: 40302210
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 46 (22.3 bits)

END